Overview

  • Product name
  • Description
    Rabbit polyclonal to FKSG14
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Synthetic peptide within Human FKSG14 aa 105-154. The exact sequence is proprietary.
    Sequence:

    EMVLSTKESKNEKLKEDLEREQRWLDEQQQIMESLNVLHSELKNKVETFS


    Database link: Q9BS16

  • Positive control
    • 293T whole cell lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab187101 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 32 kDa.

Target

  • Relevance
    FKSG14, also known as CENPK (centromere protein K) is a component of the CENPA-CAD (nucleosome distal) complex. It may be involved in incorporation of CENPA into centromeres and is required for proper kinetochore function, mitotic progression and chromosome segregation. May be involved in incorporation of newly synthesized CENPA into centromeres via its interaction with the CENPA-NAC complex. Acts in coordination with CASC5/KNL1 to recruit the NDC80 complex to the outer kinetochore. FKSG14 constitutively localized to centromeres throughout the cell cycle. There are 3 isoforms produced by alternative splicing.
  • Cellular localization
    Nuclear. Centromere. Kinetochore. Localizes exclusively in the centromeres.
  • Database links
  • Alternative names
    • AF5 alpha antibody
    • AF5alpha antibody
    • B130045K24Rik antibody
    • BB232189 antibody
    • C530004N04Rik antibody
    • CENP K antibody
    • CENPK antibody
    • Centromere protein K antibody
    • Centromeric protein K antibody
    • FKSG 14 antibody
    • FKSG14 antibody
    • ICEN 37 antibody
    • ICEN37 antibody
    • Interphase centromere complex protein 37 antibody
    • Leucine zipper protein FKSG14 antibody
    • OTTHUMP00000161888 antibody
    • P33 antibody
    • Protein AF 5alpha antibody
    • Protein AF5alpha antibody
    • Solt antibody
    • Solzt antibody
    • SoxLZ/Sox6 binding protein Solt antibody
    • SoxLZ/Sox6 leucine zipper binding protein antibody
    see all

Images

  • Anti-FKSG14 antibody (ab187101) at 1 µg/ml + 293T whole cell lysate at 10 µg

    Predicted band size: 32 kDa

References

ab187101 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab187101.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up