Anti-Flightless I antibody (ab176805)
Key features and details
- Rabbit polyclonal to Flightless I
- Suitable for: IHC-P, WB, IP
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-Flightless I antibody
See all Flightless I primary antibodies -
Description
Rabbit polyclonal to Flightless I -
Host species
Rabbit -
Tested applications
Suitable for: IHC-P, WB, IPmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Chimpanzee -
Immunogen
Synthetic peptide within Human Flightless I aa 425-475. The exact sequence is proprietary. (NP_002009.1).
Sequence:ARKMRLRRRKDSAQDDQAKQVLKGMSDVAQEKNKKQEESADARAPSGKVR R
Database link: Q13045 -
Positive control
- HeLa and 293T whole cell lysates; Human breast carcinoma tissue.
-
General notes
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.
If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 6.8
Preservative: 0.09% Sodium azide
Constituents: 0.1% BSA, 99% Tris buffered saline -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Purification notes
ab176805 was affinity purified using an epitope specific to Flightless I immobilized on solid support. -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
Applications
The Abpromise guarantee
Our Abpromise guarantee covers the use of ab176805 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
IHC-P |
1/100 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
|
|
WB |
1/2000 - 1/10000. Predicted molecular weight: 145 kDa.
|
|
IP |
Use at 2-5 µg/mg of lysate.
|
Notes |
---|
IHC-P
1/100 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. |
WB
1/2000 - 1/10000. Predicted molecular weight: 145 kDa. |
IP
Use at 2-5 µg/mg of lysate. |
Target
-
Function
May play a role as coactivator in transcriptional activation by hormone-activated nuclear receptors (NR) and acts in cooperation with NCOA2 and CARM1. Involved in estrogen hormone signaling. Involved in early embryonic development (By similarity). May play a role in regulation of cytoskeletal rearrangements involved in cytokinesis and cell migration. -
Tissue specificity
Strongest expression in skeletal muscle with high expression also in the heart and lung. -
Involvement in disease
Deletion of the FLII gene may be a cause of Smith-Magenis syndrome (SMS) [MIM:182290]. It is a contiguous gene deletion syndrome involving developmental abnormalities and mental retardation. The spectrum of clinical findings includes short stature, brachydactyly, developmental delay, dysmorphic features, sleep disturbances, and behavioral problems. -
Sequence similarities
Contains 5 gelsolin-like repeats.
Contains 15 LRR (leucine-rich) repeats. -
Cellular localization
Nucleus. Cytoplasm > cytoskeleton. Cytoplasm > cytoskeleton > centrosome. Colocalizes to actin-rich structures in blastocysts and, together with HRAS1, RHOA and CDC42, in migrating fibroblasts. Localizes to centrosomes. - Information by UniProt
-
Database links
- Entrez Gene: 454486 Chimpanzee
- Entrez Gene: 2314 Human
- Omim: 600362 Human
- SwissProt: Q13045 Human
- Unigene: 513984 Human
-
Alternative names
- Fli 1 antibody
- FLI antibody
- Fli1 antibody
see all
Images
-
All lanes : Anti-Flightless I antibody (ab176805) at 0.04 µg/ml
Lane 1 : HeLa whole cell lysate at 50 µg
Lane 2 : HeLa whole cell lysate at 15 µg
Lane 3 : HeLa whole cell lysate at 5 µg
Lane 4 : 293T whole cell lysate at 50 µg
Developed using the ECL technique.
Predicted band size: 145 kDa
Exposure time: 30 seconds -
Detection of Flightless I in Immunoprecipitates of HeLa whole cell lysate (1 mg for IP, 20% of IP loaded) using ab176805 at 3 µg/mg lysate for IP (Lane 1) and at 1 µg/ml for subsequent Western blot detection. Lane 2 represents control IgG IP.
Detection: Chemiluminescence with an exposure time of 10 seconds.
-
Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human breast carcinoma tissue labeling Flightless I with ab176805 at 1/200 dilution, followed by DAB staining.
Protocols
Datasheets and documents
-
Datasheet download
References (0)
ab176805 has not yet been referenced specifically in any publications.