Overview

  • Product name
    Anti-Flightless I antibody
    See all Flightless I primary antibodies
  • Description
    Rabbit polyclonal to Flightless I
  • Tested applications
    Suitable for: IHC-P, WB, ICC/IF, IPmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Chimpanzee
  • Immunogen

    Synthetic peptide within Human Flightless I aa 425-475. The exact sequence is proprietary. (NP_002009.1).
    Sequence:

    ARKMRLRRRKDSAQDDQAKQVLKGMSDVAQEKNKKQEESADARAPSGKVR R


    Database link: Q13045

  • Positive control
    • HeLa and 293T whole cell lysates; Human breast carcinoma tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab176805 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
WB 1/2000 - 1/10000. Predicted molecular weight: 145 kDa.
ICC/IF 1/50 - 1/500.
IP Use at 2-5 µg/mg of lysate.

Target

  • Function
    May play a role as coactivator in transcriptional activation by hormone-activated nuclear receptors (NR) and acts in cooperation with NCOA2 and CARM1. Involved in estrogen hormone signaling. Involved in early embryonic development (By similarity). May play a role in regulation of cytoskeletal rearrangements involved in cytokinesis and cell migration.
  • Tissue specificity
    Strongest expression in skeletal muscle with high expression also in the heart and lung.
  • Involvement in disease
    Deletion of the FLII gene may be a cause of Smith-Magenis syndrome (SMS) [MIM:182290]. It is a contiguous gene deletion syndrome involving developmental abnormalities and mental retardation. The spectrum of clinical findings includes short stature, brachydactyly, developmental delay, dysmorphic features, sleep disturbances, and behavioral problems.
  • Sequence similarities
    Contains 5 gelsolin-like repeats.
    Contains 15 LRR (leucine-rich) repeats.
  • Cellular localization
    Nucleus. Cytoplasm > cytoskeleton. Cytoplasm > cytoskeleton > centrosome. Colocalizes to actin-rich structures in blastocysts and, together with HRAS1, RHOA and CDC42, in migrating fibroblasts. Localizes to centrosomes.
  • Information by UniProt
  • Database links
  • Alternative names
    • Fli 1 antibody
    • FLI antibody
    • Fli1 antibody
    • Flightless 1 antibody
    • Flightless I (Drosophila) homolog antibody
    • Flightless I homolog antibody
    • Flightless I homolog (Drosophila) antibody
    • Flightless1 antibody
    • FlightlessI antibody
    • fliI antibody
    • FLII_HUMAN antibody
    • Fliih antibody
    • FLIL antibody
    • MGC39265 antibody
    • Protein flightless 1 homolog antibody
    • Protein flightless-1 homolog antibody
    see all

Images

  • All lanes : Anti-Flightless I antibody (ab176805) at 0.04 µg/ml

    Lane 1 : HeLa whole cell lysate at 50 µg
    Lane 2 : HeLa whole cell lysate at 15 µg
    Lane 3 : HeLa whole cell lysate at 5 µg
    Lane 4 : 293T whole cell lysate at 50 µg

    Developed using the ECL technique

    Predicted band size : 145 kDa


    Exposure time : 30 seconds
  • Detection of Flightless I in Immunoprecipitates of HeLa whole cell lysate (1 mg for IP, 20% of IP loaded) using ab176805 at 3 µg/mg lysate for IP (Lane 1) and at 1 µg/ml for subsequent Western blot detection. Lane 2 represents control IgG IP.

    Detection: Chemiluminescence with an exposure time of 10 seconds.

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human breast carcinoma tissue labeling Flightless I with ab176805 at 1/200 dilution, followed by DAB staining.

References

ab176805 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab176805.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up