Overview

  • Product name
    Anti-FNTA antibody - C-terminal
    See all FNTA primary antibodies
  • Description
    Rabbit polyclonal to FNTA - C-terminal
  • Tested applications
    Suitable for: WB, IPmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Rhesus monkey, Gorilla, Common marmoset
  • Immunogen

    Synthetic peptide within Human FNTA aa 329-379 (C terminal). The exact sequence is proprietary. NP_002018.1.
    Sequence:

    NKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSKHSTENDSPTNVQ Q


    Database link: P49354

  • Positive control
    • HeLa, 293T and Jurkat whole cell lysates.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    Preservative: 0.09% Sodium azide
    Constituent: 99% Tris citrate/phosphate

    pH 7 to 8
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Purification notes
    ab186136 was affinity purified using an epitope specific to FNTA immobilized on a solid support.
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab186136 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/2000 - 1/10000. Predicted molecular weight: 44 kDa.
IP Use at 2-10 µg/mg of lysate.

Target

  • Function
    Catalyzes the transfer of a farnesyl or geranyl-geranyl moiety from farnesyl or geranyl-geranyl pyrophosphate to a cysteine at the fourth position from the C-terminus of several proteins having the C-terminal sequence Cys-aliphatic-aliphatic-X. The alpha subunit is thought to participate in a stable complex with the substrate. The beta subunit binds the peptide substrate. Through RAC1 prenylation and activation may positively regulate neuromuscular junction development downstream of MUSK.
  • Sequence similarities
    Belongs to the protein prenyltransferase subunit alpha family.
    Contains 5 PFTA repeats.
  • Post-translational
    modifications
    Phosphorylated. Phosphorylation is mediated by MUSK upon AGRIN stimulation and results in the activation of FNTA.
  • Information by UniProt
  • Database links
  • Alternative names
    • CAAX farnesyltransferase alpha subunit antibody
    • CAAX farnesyltransferase subunit alpha antibody
    • EC 2.5.1.58 antibody
    • EC 2.5.1.59 antibody
    • Farnesyl protein transferase alpha subunit antibody
    • Farnesyltransferase CAAX box alpha antibody
    • Farnesyltransferase, CAAX box, alpha antibody
    • Fnta antibody
    • FNTA_HUMAN antibody
    • FPTA antibody
    • FTase alpha antibody
    • FTase-alpha antibody
    • GGTase I alpha antibody
    • GGTase-I-alpha antibody
    • MGC99680 antibody
    • OTTHUMP00000229206 antibody
    • OTTHUMP00000229262 antibody
    • PGGT1A antibody
    • Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit antibody
    • Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha antibody
    • Protein prenyltransferase alpha subunit repeat containing 2 antibody
    • PTAR2 antibody
    • Ras proteins prenyltransferase alpha antibody
    • Ras proteins prenyltransferase subunit alpha antibody
    • Type I protein geranyl geranyltransferase alpha subunit antibody
    • Type I protein geranyl-geranyltransferase subunit alpha antibody
    see all

Images

  • Detection of FNTA in Immunoprecipitates of 293T whole cell lysates (1 mg for IP, 20% of IP loaded) using ab186136 at 6 µg per reaction for IP (Lane 1). For WB detection, ab186136 was used at 1µg/ml. Lane 2 Control IgG IP. Detection: Chemiluminescence with an exposure time of 30 seconds.

  • All lanes : Anti-FNTA antibody - C-terminal (ab186136) at 0.1 µg/ml

    Lane 1 : HeLa whole cell lysate
    Lane 2 : 293T whole cell lysate
    Lane 3 : Jurkat whole cell lysate

    Lysates/proteins at 50 µg per lane.

    Developed using the ECL technique

    Predicted band size : 44 kDa


    Exposure time : 3 minutes

References

ab186136 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab186136.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up