• Product nameAnti-FOXL2 antibody
    See all FOXL2 primary antibodies
  • Description
    Rabbit polyclonal to FOXL2
  • Tested applicationsSuitable for: ELISA, WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Dog, Pig
  • Immunogen

    A region within synthetic peptide: MMASYPEPED AAGALLAPET GRTVKEPEGP PPSPGKGGGG GGGTAPEKPD, corresponding to N terminal amino acids 1-50 of Human FOXL2

  • Positive control
    • Jurkat cell lysate


Associated products


Our Abpromise guarantee covers the use of ab49293 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ELISA Use at an assay dependent concentration.

ELISA titre using peptide based assay: 1:312500.

WB Use a concentration of 1.25 µg/ml. Detects a band of approximately 44 kDa (predicted molecular weight: 39 kDa). Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.


  • FunctionTranscriptional regulator. Critical factor essential for ovary differentiation and maintenance, and repression of the genetic program for somatic testis determination. Prevents trans-differentiation of ovary to testis throught transcriptional repression of the Sertoli cell-promoting gene SOX9 (By similarity). Has apoptotic activity in ovarian cells. Suppresses ESR1-mediated transcription of PTGS2/COX2 stimulated by tamoxifen (By similarity). Is a regulator of CYP19 expression (By similarity). Participates in SMAD3-dependent transcription of FST via the intronic SMAD-binding element (By similarity). Is a transcriptional repressor of STAR. Activates SIRT1 transcription under cellular stress conditions. Activates transcription of OSR2.
  • Tissue specificityIn addition to its expression in the developing eyelid, it is transcribed very early in somatic cells of the developing gonad (before sex determination) and its expression persists in the follicular cells of the adult ovary.
  • Involvement in diseaseDefects in FOXL2 are a cause of blepharophimosis, ptosis, and epicanthus inversus syndrome (BPES) [MIM:110100]; also known as blepharophimosis syndrome. It is an autosomal dominant disorder characterized by eyelid dysplasia, small palpebral fissures, drooping eyelids and a skin fold running inward and upward from the lower lid. In type I BPSE (BPES1) eyelid abnormalities are associated with female infertility. Affected females show an ovarian deficit due to primary amenorrhea or to premature ovarian failure (POF). In type II BPSE (BPES2) affected individuals show only the eyelid defects. There is a mutational hotspot in the region coding for the poly-Ala domain, since 30% of all mutations in the ORF lead to poly-Ala expansions, resulting mainly in BPES type II.
    Defects in FOXL2 are a cause of premature ovarian failure type 3 (POF3) [MIM:608996]. An ovarian disorder defined as the cessation of ovarian function under the age of 40 years. It is characterized by oligomenorrhea or amenorrhea, in the presence of elevated levels of serum gonadotropins and low estradiol.
  • Sequence similaritiesContains 1 fork-head DNA-binding domain.
  • Post-translational
    Sumoylated by SUMO1; sumoylation is required for transcriptional repression activity.
  • Cellular localizationNucleus.
  • Information by UniProt
  • Database links
  • Alternative names
    • Blepharophimosis antibody
    • Blepharophimosis epicanthus inversus and ptosis 1 antibody
    • Blepharophimosis epicanthus inversus and ptosis antibody
    • BPES 1 antibody
    • BPES antibody
    • BPES1 antibody
    • Epicanthus inversus and ptosis 1 antibody
    • Forkhead box L2 antibody
    • Forkhead box protein L2 antibody
    • Forkhead transcription factor FOXL2 antibody
    • FOX L2 antibody
    • FOXL 2 antibody
    • FOXL2 antibody
    • FOXL2_HUMAN antibody
    • PFRK antibody
    • PINTO antibody
    • POF 3 antibody
    • POF3 antibody
    see all

Anti-FOXL2 antibody images

  • Lane 1 :
    Lane 2 : Anti-FOXL2 antibody (ab49293) at 1.25 µg/ml

    Lane 1 : MW marker
    Lane 2 : Jurkat cell lysate at 10 µg

    Lane 2 : HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 39 kDa
    Observed band size : 44 kDa (why is the actual band size different from the predicted?)

References for Anti-FOXL2 antibody (ab49293)

ab49293 has not yet been referenced specifically in any publications.

Product Wall

We are unable to supply the exact immunogen sequence for this antibody, however, we can inform you that it is within this sequence: MMASYPEPEDAAGALLAPETGRTVKEPEGPPPSPGKGGGGGGGTAPEKPD I hope this information will be useful. Please do not hesitate to...

Read More