Overview

  • Product nameAnti-Frequenin antibody
    See all Frequenin primary antibodies
  • Description
    Rabbit polyclonal to Frequenin
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Rat
    Predicted to work with: Mouse, Chicken, Cow, Human, Xenopus laevis, Drosophila melanogaster
  • Immunogen

    Synthetic peptide corresponding to Rat Frequenin aa 161-190.
    Sequence:

    DGKLTLQEFQEGSKADPSIVQALSLYDGLV

  • Positive control
    • Rat brain extract.

Properties

  • FormLiquid
  • Storage instructionsShipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
  • Storage bufferPreservative: 0.05% Sodium azide
    Constituents: 0.1% BSA, 99% PBS
  • Concentration information loading...
  • PurityImmunogen affinity purified
  • Primary antibody notesThe neuronal calcium sensor (NCS) proteins are bind calcium through EF-hand motifs and are predominantly expressed in neurons. Photoreceptor cells express type A sensors and include the proteins recoverin, S-modulin, and visinin. Type B receptors are expressed in neurons and include NCS1 and the Drosophila homolog frequenin, and VILIP. NCS1 has been shown to regulate neurosecretion in a calcium-dependent manner, potentiates nitric oxide synthase activity, and can activate calcineurin and 3'-5' nucleotide phosphodiesterase.
  • ClonalityPolyclonal
  • IsotypeIgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab5807 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Detects a band of approximately 20 kDa (predicted molecular weight: 25 kDa).

Target

  • FunctionNeuronal calcium sensor, regulator of G protein-coupled receptor phosphorylation in a calcium dependent manner. Directly regulates GRK1 (RHOK), but not GRK2 to GRK5. Can substitute for calmodulin (By similarity). Stimulates PI4KB kinase activity (By similarity). Involved in long-term synaptic plasticity through its interaction with PICK1 (By similarity). May also play a role in neuron differentiation through inhibition of the activity of N-type voltage-gated calcium channel.
  • Sequence similaritiesBelongs to the recoverin family.
    Contains 4 EF-hand domains.
  • Cellular localizationGolgi apparatus > Golgi stack membrane. Cell junction > synapse > postsynaptic cell membrane > postsynaptic density. Cytoplasm > perinuclear region. Cell membrane. Associated with Golgi stacks. Post-synaptic densities of dendrites, and in the pre-synaptic nerve terminal at neuromuscular junctions.
  • Information by UniProt
  • Database links
  • Alternative names
    • Flup antibody
    • Freq antibody
    • frequenin (Drosophila) homolog antibody
    • Frequenin homolog antibody
    • Frequenin-like protein antibody
    • Frequenin-like ubiquitous protein antibody
    • NCS-1 antibody
    • ncs1 antibody
    • NCS1_HUMAN antibody
    • Neuronal calcium sensor 1 antibody
    see all

References for Anti-Frequenin antibody (ab5807)

ab5807 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab5807.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"