Overview

  • Product nameAnti-Frizzled 4 antibody
    See all Frizzled 4 primary antibodies
  • Description
    Rabbit polyclonal to Frizzled 4
  • Tested applicationsSuitable for: ICC/IF, IHC-P, WBmore details
  • Species reactivity
    Reacts with: Mouse, Rat, Horse, Dog, Human
    Predicted to work with: Chicken, Guinea pig, Cow, Cat
  • Immunogen

    Synthetic peptide corresponding to Human Frizzled 4 aa 488-537 (internal sequence).
    Sequence:

    GITSGMWIWSAKTLHTWQKCSNRLVNSGKVKREKRGNGWVKPGKGSETVV


    Database link: NP_036325

  • Positive control
    • Fetal liver lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab83042 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 5 µg/ml.
IHC-P Use a concentration of 4 - 8 µg/ml.
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 60 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • FunctionReceptor for Wnt proteins. Most of frizzled receptors are coupled to the beta-catenin (CTNNB1) canonical signaling pathway, which leads to the activation of disheveled proteins, inhibition of GSK-3 kinase, nuclear accumulation of beta-catenin (CTNNB1) and activation of Wnt target genes. Plays a critical role in retinal vascularization by acting as a receptor for Wnt proteins and norrin (NDP). In retina, it can be both activated by Wnt protein-binding, but also by a Wnt-independent signaling via binding of norrin (NDP), promoting in both cases beta-catenin (CTNNB1) accumulation and stimulation of LEF/TCF-mediated transcriptional programs. A second signaling pathway involving PKC and calcium fluxes has been seen for some family members, but it is not yet clear if it represents a distinct pathway or if it can be integrated in the canonical pathway, as PKC seems to be required for Wnt-mediated inactivation of GSK-3 kinase. Both pathways seem to involve interactions with G-proteins. May be involved in transduction and intercellular transmission of polarity information during tissue morphogenesis and/or in differentiated tissues.
  • Tissue specificityAlmost ubiquitous. Largely expressed in adult heart, skeletal muscle, ovary, and fetal kidney. Moderate amounts in adult liver, kidney, pancreas, spleen, and fetal lung, and small amounts in placenta, adult lung, prostate, testis, colon, fetal brain and liver.
  • Involvement in diseaseDefects in FZD4 are the cause of vitreoretinopathy exudative type 1 (EVR1) [MIM:133780]; also known as autosomal dominant familial exudative vitreoretinopathy (FEVR) or Criswick-Schepens syndrome. EVR1 is a disorder of the retinal vasculature characterized by an abrupt cessation of growth of peripheral capillaries, leading to an avascular peripheral retina. This may lead to compensatory retinal neovascularization, which is thought to be induced by hypoxia from the initial avascular insult. New vessels are prone to leakage and rupture causing exudates and bleeding, followed by scarring, retinal detachment and blindness. Clinical features can be highly variable, even within the same family. Patients with mild forms of the disease are asymptomatic, and their only disease-related abnormality is an arc of avascular retina in the extreme temporal periphery.
  • Sequence similaritiesBelongs to the G-protein coupled receptor Fz/Smo family.
    Contains 1 FZ (frizzled) domain.
  • DomainLys-Thr-X-X-X-Trp motif interacts with the PDZ doman of Dvl (Disheveled) family members and is involved in the activation of the Wnt/beta-catenin signaling pathway.
    The FZ domain is involved in binding with Wnt ligands.
  • Cellular localizationMembrane. Cell membrane.
  • Information by UniProt
  • Database links
  • Alternative names
    • CD 344 antibody
    • CD 344 antigen antibody
    • CD344 antibody
    • CD344 antigen antibody
    • EVR1 antibody
    • FEVR antibody
    • Frizzled (Drosophila) homolog 4 antibody
    • Frizzled 4 antibody
    • Frizzled family receptor 4 antibody
    • Frizzled homolog 4 (Drosophila) antibody
    • Frizzled-4 antibody
    • Fz 4 antibody
    • Fz-4 antibody
    • Fz4 antibody
    • FZD4 antibody
    • FZD4_HUMAN antibody
    • FZD4S antibody
    • FzE4 antibody
    • GPCR antibody
    • hFz4 antibody
    • MGC34390 antibody
    • WNT receptor frizzled 4 antibody
    see all

Anti-Frizzled 4 antibody images

  • Anti-Frizzled 4 antibody (ab83042) at 1 µg/ml + fetal liver lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 60 kDa
    Observed band size : 65 kDa (why is the actual band size different from the predicted?)
    Gel concentration 12%
  • ICC/IF image of ab83042 stained MCF7 cells. The cells were 4% PFA fixed (10mins) and then incubated in 1%BSA / 10% normal goat serum / 0.3M glycine in 0.1% PBS-Tween for 1h to permeabilise the cells and block non-specific protein-protein interactions. The cells were then incubated with the antibody (ab83042, 5µg/ml) overnight at +4°C. The secondary antibody (green) was ab96899 Dylight 488 goat anti-rabbit IgG (H+L) used at a 1/250 dilution for 1h. Alexa Fluor® 594 WGA was used to label plasma membranes (red) at a 1/200 dilution for 1h. DAPI was used to stain the cell nuclei (blue) at a concentration of 1.43µM.

  • Immunohistochemistry (Formalin/PFa-fixed paraffin-embedded sections) analysis of human skin tissue labelling Frizzeled 4 with ab83042 at 4-8µg/ml.

  • ab83042 staining Frizzled 4 in rat brain tissue sections by Immunohistochemistry (IHC-P - formaldehyde-fixed, paraffin-embedded sections). Tissue was fixed with formaldehyde and blocked with 2% BSA for 10 minutes at 21°C; antigen retrieval was by heat mediation in a citrate buffer. Samples were incubated with primary antibody (1/10000 in TBS/BSA/azide) for 2 hours at 21°C. A Biotin-conjugated goat anti-rabbit IgG polyclonal (1/300) was used as the secondary antibody.

  • ab83042 staining Frizzled 4 in human epithelium tissue sections (top image - skin, bottom image - bronchiolar epithelium) by Immunohistochemistry (IHC-P - paraformaldehyde-fixed, paraffin-embedded sections). Tissue was fixed with formaldehyde and blocked with 1% BSA for 10 minutes at 21°C; antigen retrieval was by heat mediation in citric acid. Samples were incubated with primary antibody (1/6000 in TBS/BSA/azide) for 2 hours at 21°C. A Biotin-conjugated goat anti-rabbit IgG polyclonal (1/300) was used as the secondary antibody.

    See Abreview

References for Anti-Frizzled 4 antibody (ab83042)

This product has been referenced in:
  • Wang L  et al. Impact of laminitis on the canonical Wnt signaling pathway in basal epithelial cells of the equine digital laminae. PLoS One 8:e56025 (2013). ICC/IF ; Horse . Read more (PubMed: 23405249) »
  • McIver SC  et al. A unique combination of male germ cell miRNAs coordinates gonocyte differentiation. PLoS One 7:e35553 (2012). WB ; Mouse . Read more (PubMed: 22536405) »

See all 3 Publications for this product

Product Wall

Application Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Sample Mouse Tissue sections (Brain)
Antigen retrieval step Heat mediated - Buffer/Enzyme Used: Citric acid
Permeabilization No
Specification Brain
Blocking step BSA as blocking agent for 10 minute(s) · Concentration: 2% · Temperature: 21°C
Fixative Formaldehyde
Username

Mr. Carl Hobbs

Verified customer

Submitted May 25 2016

Application Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Sample Dog Tissue sections (Brain)
Antigen retrieval step Heat mediated - Buffer/Enzyme Used: Citric acid
Permeabilization No
Specification Brain
Blocking step BSA as blocking agent for 10 minute(s) · Concentration: 2% · Temperature: 21°C
Fixative Formaldehyde
Username

Mr. Carl Hobbs

Verified customer

Submitted May 25 2016

Application Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Sample Rat Tissue sections (Brain)
Antigen retrieval step Heat mediated - Buffer/Enzyme Used: Citric acid
Permeabilization No
Specification Brain
Blocking step BSA as blocking agent for 10 minute(s) · Concentration: 2% · Temperature: 21°C
Fixative Formaldehyde
Username

Mr. Carl Hobbs

Verified customer

Submitted May 24 2016

Application Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Blocking step BSA as blocking agent for 10 minute(s) · Concentration: 1% · Temperature: 21°C
Antigen retrieval step Heat mediated - Buffer/Enzyme Used: Citric acid
Sample Human Tissue sections (Epithelium)
Specification Epithelium
Permeabilization No
Fixative Formaldehyde
Username

Mr. Carl Hobbs

Verified customer

Submitted Feb 19 2015

Thank you for confirming these details and for your cooperation. The details provided enable us to closely monitor the quality of our products.
I am sorry this product did not perform as stated on the datasheet and for the inconvenience this has c...

Read More

Thank you for your email. I am sorry to hear that you have been experiencing problems with this antibody.
I have read the details you have kindly provided and have following further questions for better understanding of the problem;
- Have you ...

Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"