Overview

  • Product name
  • Description
    Rabbit polyclonal to FRMD8
  • Tested applications
    Suitable for: IHC-P, WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment corresponding to Human FRMD8 aa 17-153.
    Sequence:

    SHRSSVSSVGARAADVLVYLADDTVVPLAVENLPSLSAHELHRAVREVLQ LPDIALDVFA LWLVSPLLEVQLKPKHQPYKLGRQWPELLLRFTSAPDDDVAMDEPFLQFR RNVFFPKRRE LQIHDEEVLRLLYEEAK


    Database link: Q9BZ67

  • Positive control
    • HeLa and Jurkat cell lysates; Human fetal colon tissue.

Properties

  • Form
    Lyophilised:Reconstitute in 200ul sterile Water with 50% glycerol to a final concentration of 0.5 mg/ml
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 98% PBS, 1% BSA
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab169933 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100 - 1/500.
WB 1/1000 - 1/2000. Detects a band of approximately 45, 51 kDa (predicted molecular weight: 45, 51 kDa).

Target

Images

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human fetal colon labelling FRMD8 with ab169933 at a dilution of 1/100.

  • All lanes : Anti-FRMD8 antibody (ab169933) at 1/1000 dilution

    Lane 1 : HeLa cell lysate
    Lane 2 : Jurkat cell lysate


    Predicted band size : 45, 51 kDa

References

ab169933 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab169933.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up