Overview

  • Product nameAnti-FRZB antibody
    See all FRZB primary antibodies
  • Description
    Rabbit polyclonal to FRZB
  • Tested applicationsSuitable for: IHC-P, WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Zebrafish
  • Immunogen

    Synthetic peptide corresponding to a region within internal amino acids 216-265 (VVEVKEILKSSLVNIPRDTVNLYTSSGCLCPPLNVNEEYIIMGYEDEER S) of Human FRZB (NP_001454).

Properties

Applications

Our Abpromise guarantee covers the use of ab108169 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 µg/ml.
WB Use a concentration of 0.25 µg/ml. Predicted molecular weight: 36 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • RelevanceSFRP3/FRZB appears to be involved in limb skeletogenesis by regulating chondrocyte maturation and long bone development. Soluble frizzled-related proteins (sFRPS) function as modulators of Wnt signaling through direct interaction with Wnts. They have a role in regulating cell growth and differentiation in specific cell types. Antagonist of Wnt8 signaling.
  • Cellular localizationSecreted
  • Database links
  • Alternative names
    • FIZ antibody
    • FRE antibody
    • Frezzled antibody
    • Fritz antibody
    • Frizzled-related protein 1 antibody
    • FRP antibody
    • FrzB 1 antibody
    • FRZB antibody
    • FRZB1 antibody
    • OTTMUSP00000014350 antibody
    • RP23-33L19.1 antibody
    • Secreted frizzled related protein 3 [Precursor] antibody
    • Secreted frizzled related sequence protein 3 antibody
    • sFRP 3 antibody
    • SFRP antibody
    see all

Anti-FRZB antibody images

  • Anti-FRZB antibody (ab108169) at 0.2 µg/ml + Transfected 293T

    Predicted band size : 36 kDa
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human spleen tissue labelling FRZB with ab108169 at 5µg/ml.

References for Anti-FRZB antibody (ab108169)

ab108169 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab108169.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"