Overview

  • Product nameAnti-FUT8 antibody
    See all FUT8 primary antibodies
  • Description
    Rabbit polyclonal to FUT8
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Pig, Zebrafish
  • Immunogen

    Synthetic peptide corresponding to a region within N terminal amino acids 27-76 (

    LVQRRITYLQNPKDCSKAKKLVCNINKGCGYGCQLHHVVYCFMIAYGTQR

    ) of Human FUT8 (NP_004471).

  • Positive control
    • Human fetal liver lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab115925 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 67 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • FunctionCatalyzes the addition of fucose in alpha 1-6 linkage to the first GlcNAc residue, next to the peptide chains in N-glycans.
  • PathwayProtein modification; protein glycosylation.
  • Sequence similaritiesBelongs to the glycosyltransferase 23 family.
    Contains 1 SH3 domain.
  • Cellular localizationGolgi apparatus > Golgi stack membrane. Membrane-bound form in trans cisternae of Golgi.
  • Information by UniProt
  • Database links
  • FormThe expression of this gene may contribute to the malignancy of cancer cells and to their invasive and metastatic capabilities. There are 2 isoforms produced by alternative splicing. Immunogen is not present in isoform 2 (also known as Retinal).
  • Alternative names
    • 6-fucosyltransferase antibody
    • Alpha (1,6) fucosyltransferase antibody
    • Alpha-(1,6)-fucosyltransferase antibody
    • Alpha1 6FucT antibody
    • alpha1-6FucT antibody
    • Fucosyltransferase 8 (alpha (1,6) fucosyltransferase) antibody
    • Fucosyltransferase 8 antibody
    • FUT8 antibody
    • FUT8_HUMAN antibody
    • GDP fucose glycoprotein fucosyltransferase antibody
    • GDP L Fuc:N acetyl beta D glucosaminide alpha1,6 fucosyltransferase antibody
    • GDP-fucose--glycoprotein fucosyltransferase antibody
    • GDP-L-Fuc:N-acetyl-beta-D-glucosaminide alpha1 antibody
    • Glycoprotein 6 alpha L fucosyltransferase antibody
    • Glycoprotein 6-alpha-L-fucosyltransferase antibody
    • MGC26465 antibody
    see all

Anti-FUT8 antibody images

  • Anti-FUT8 antibody (ab115925) at 1 µg/ml + Human fetal liver lysate at 10 µg

    Predicted band size : 67 kDa

References for Anti-FUT8 antibody (ab115925)

ab115925 has not yet been referenced specifically in any publications.

Product Wall

Application Western blot
Loading amount 30 µg
Gel Running Conditions Reduced Denaturing (7.5% gel)
Sample Chinese Hamster Cell lysate - whole cell (ovary cell)
Specification ovary cell
Blocking step Milk as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 37°C
Username

Daniel Wang

Verified customer

Submitted Oct 13 2014

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"