Overview

  • Product nameAnti-FXYD3 antibody
    See all FXYD3 primary antibodies
  • Description
    Mouse polyclonal to FXYD3
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Full length FXYD3 protein (Human)

  • Positive control
    • Transfected 293T cell lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab67067 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB
  • Application notesWB: 1/500 - 1/1000. Detects a band of approximately 14 kDa (predicted molecular weight: 9 kDa).
    Detection Antibody Pair.

    Not yet tested in other applications.
    Optimal dilutions/concentrations should be determined by the end user.
  • Target

    • FunctionInduces a hyperpolarization-activated chloride current when expressed in Xenopus oocytes. May be a modulator capable of activating endogenous oocyte channels.
    • Tissue specificityExpressed in a subset of human breast tumors.
    • Sequence similaritiesBelongs to the FXYD family.
    • Cellular localizationMembrane.
    • Information by UniProt
    • Database links
    • Alternative names
      • Chloride conductance inducer protein Mat 8 antibody
      • Chloride conductance inducer protein Mat-8 antibody
      • FXYD domain containing ion transport regulator 3 antibody
      • FXYD domain-containing ion transport regulator 3 antibody
      • Fxyd3 antibody
      • FXYD3_HUMAN antibody
      • Mammary tumor 8 kDa protein antibody
      • MAT-8 antibody
      • MAT8 antibody
      • MGC111076 antibody
      • Phospholemman like antibody
      • Phospholemman-like antibody
      • PLML antibody
      see all

    Anti-FXYD3 antibody images

    • All lanes : Anti-FXYD3 antibody (ab67067) at 1/500 dilution

      Lane 1 : FXYD3 transfected 293T cell lysate
      Lane 2 : Non-transfected 293T cell lysate

      Lysates/proteins at 25 µg/ml per lane.

      Secondary
      Goat Anti-Mouse IgG (H&L)-HRP Conjugate at 1/2500 dilution

      Predicted band size : 9 kDa
      Observed band size : 14 kDa (why is the actual band size different from the predicted?)
      Additional bands at : 13 kDa. We are unsure as to the identity of these extra bands.

    References for Anti-FXYD3 antibody (ab67067)

    ab67067 has not yet been referenced specifically in any publications.

    Product Wall

    AV67067 anti-FXYD3 antibody was created using the full length FXYD3 protein (Human). The sequence for this is: NDLEDKNSPFYYDWHSLQVGGLICAGVLCAMGIIIVMSAKCKCKFGQKSGHHPGETPPLITPGSAQS

    Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"