Overview

  • Product nameAnti-G gamma14 antibody
    See all G gamma14 primary antibodies
  • Description
    Rabbit polyclonal to G gamma14
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Cow, Cat, Dog
  • Immunogen

    A synthetic peptide corresponding to a region within the internal sequence 19-68 (

    KEVKNTRIPISKAGKEIKEYVEAQAGNDPFLKGIPEDKNPFKEKGGCLIS

    ) of Human G gamma14 (NP_113686).

  • Positive control
    • 293T cell lysate.

Properties

  • FormLiquid
  • Storage instructionsShipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.
  • Storage bufferPreservative: None
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • PurityImmunogen affinity purified
  • ClonalityPolyclonal
  • IsotypeIgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab83786 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Detects a band of approximately 14 kDa (predicted molecular weight: 8 kDa). Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • FunctionGuanine nucleotide-binding proteins (G proteins) are involved as a modulator or transducer in various transmembrane signaling systems. The beta and gamma chains are required for the GTPase activity, for replacement of GDP by GTP, and for G protein-effector interaction.
  • Tissue specificityRetinal cones.
  • Sequence similaritiesBelongs to the G protein gamma family.
  • Cellular localizationCell membrane.
  • Information by UniProt
  • Database links
  • Alternative names
    • G GAMMA 8 antibody
    • G gamma 9 antibody
    • G GAMMA C antibody
    • G gamma-C antibody
    • G protein cone gamma 8 subunit antibody
    • G-gamma-8 antibody
    • G-gamma-9 antibody
    • gamma T2 subunit antibody
    • GBGT2_HUMAN antibody
    • GNG8 antibody
    • GNG9 antibody
    • GNGT2 antibody
    • GNGT8 antibody
    • guanine nucleotide binding protein (G protein), gamma transducing activity polypeptide 2 antibody
    • guanine nucleotide binding protein (G protein), gamma transducing antibody
    • Guanine nucleotide binding protein G antibody
    • guanine nucleotide binding protein gamma 9 antibody
    • guanine nucleotide binding protein gamma transducing activity antibody
    • Guanine nucleotide binding protein gamma transducing activity polypeptide 2 antibody
    • Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-T2 antibody
    • IG antibody
    • Ogamma T2 subunit precursor antibody
    • SG antibody
    see all

Anti-G gamma14 antibody images

  • Anti-G gamma14 antibody (ab83786) at 1 µg/ml (5% skim milk / PBS buffer) + 293T cell lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 8 kDa
    Observed band size : 14 kDa (why is the actual band size different from the predicted?)

References for Anti-G gamma14 antibody (ab83786)

ab83786 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab83786.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"