Overview

  • Product name
  • Description
    Rabbit polyclonal to G3BP2
  • Host species
    Rabbit
  • Specificity
    ab190011 detects endogenous levels of total G3BP2 protein.
  • Tested applications
    Suitable for: WB, IHC-Pmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Synthetic peptide within Human G3BP2 aa 433-482. The exact sequence is proprietary. NP_036429.2
    Sequence:

    GPGGPRGIVGGGMMRDRDGRGPPPRGGMAQKLGSGRGTGQMEGRFTGQRR


    Database link: Q9UN86

  • Positive control
    • Human brain cortex tissue; extracts from HeLa, HUVEC and A549 cells.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    pH: 7.4
    Preservative: 0.02% Sodium azide
    Constituents: 49% PBS, 50% Glycerol, 0.87% Sodium chloride

    PBS is without Mg2+ and Ca2+.
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab190011 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/1000. Predicted molecular weight: 54 kDa.
IHC-P Use a concentration of 10 µg/ml.

Target

  • Function
    Probable scaffold protein that may be involved in mRNA transport.
  • Sequence similarities
    Contains 1 NTF2 domain.
    Contains 1 RRM (RNA recognition motif) domain.
  • Post-translational
    modifications
    Arg-457 and Arg-468 are dimethylated, probably to asymmetric dimethylarginine.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt
  • Database links
  • Alternative names
    • G3BP 2 antibody
    • G3BP-2 antibody
    • G3BP2 antibody
    • G3BP2_HUMAN antibody
    • GAP SH3 domain binding protein 2 antibody
    • GAP SH3 domain-binding protein 2 antibody
    • GTPase activating protein (SH3 domain) binding protein 2 antibody
    • Ras GTPase activating protein SH3 domain binding protein 2 antibody
    • Ras GTPase-activating protein-binding protein 2 antibody
    see all

Images

  • Immunohistochemical analysis of formalin fixed, paraffin-embedded Human brain, cortex tissue labeling G3BP2 with ab190011 at 10 µg/ml.

  • All lanes : Anti-G3BP2 antibody (ab190011) at 1/500 dilution

    Lane 1 : extracts from A549 cells
    Lane 2 : extracts from HUVEC cells
    Lane 3 : extracts from HeLa cells
    Lane 4 : extracts from HeLa cells with synthesized peptide

    Predicted band size: 54 kDa

References

ab190011 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab190011.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up