Overview

  • Product name
  • Description
    Rabbit polyclonal to GABRR1
  • Host species
    Rabbit
  • Tested applications
    Suitable for: IHC-P, WBmore details
  • Species reactivity
    Reacts with: Mouse, Rat, Human
  • Immunogen

    Recombinant fragment corresponding to Human GABRR1 aa 365-465.
    Sequence:

    VNYLTTVQERKEQKLREKLPCTSGLPPPRTAMLDGNYSDGEVNDLDNYMP ENGEKPDRMMVQLTLASERSSPQRKSQRSSYVSMRIDTHAIDKYSRIIFP A


    Database link: P24046

  • Positive control
    • A673, Mouse eye, Mouse heart and Mouse skeletal muscle extracts.

Properties

Applications

Our Abpromise guarantee covers the use of ab189875 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200.
WB 1/500 - 1/2000. Predicted molecular weight: 56 kDa.

Target

  • Function
    GABA, the major inhibitory neurotransmitter in the vertebrate brain, mediates neuronal inhibition by binding to the GABA/benzodiazepine receptor and opening an integral chloride channel. Rho-1 GABA receptor could play a role in retinal neurotransmission.
  • Tissue specificity
    Highly expressed in the retina and in a lesser extent in brain, lung and thymus.
  • Sequence similarities
    Belongs to the ligand-gated ion channel (TC 1.A.9) family. Gamma-aminobutyric acid receptor (TC 1.A.9.5) subfamily. GABRR1 sub-subfamily.
  • Cellular localization
    Cell junction > synapse > postsynaptic cell membrane. Cell membrane.
  • Information by UniProt
  • Database links
  • Alternative names
    • bA135P14.1 (gamma-aminobutyric acid (GABA) receptor rho 1) antibody
    • GABA(A) receptor subunit rho-1 antibody
    • GABA(C) receptor antibody
    • GABRR1 antibody
    • gamma aminobutyric acid receptor rho 1 antibody
    • gamma-aminobutyric acid (GABA) A receptor rho-1 antibody
    • gamma-aminobutyric acid (GABA) receptor rho 1 antibody
    • Gamma-aminobutyric acid receptor subunit rho-1 antibody
    • GBRR1_HUMAN antibody
    • MGC163216 antibody
    see all

Images

  • All lanes : Anti-GABRR1 antibody (ab189875) at 1/500 dilution

    Lane 1 : A673 cell line extract
    Lane 2 : Mouse eye extract
    Lane 3 : Mouse heart extract
    Lane 4 : Mouse skeletal muscle extract

    Predicted band size: 56 kDa

References

ab189875 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Abcam has not validated the combination of species/application used in this Abreview.
Application
IHC - Wholemount
Sample
Mouse Tissue (Cell type)
Specification
Cell type
Username

Susan Lynn Wohlgenant

Verified customer

Submitted Mar 02 2018

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up