Overview

  • Product name
  • Description
    Rabbit polyclonal to GAK
  • Specificity
    ab190231 detects endogenous levels of total GAK protein.
  • Tested applications
    Suitable for: IHC-P, WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Synthetic peptide within Human GAK aa 101-150. The exact sequence is proprietary.
    Sequence:

    FCSAASIGKEESDTGQAEFLLLTELCKGQLVEFLKKMESRGPLSCDTVLK


    Database link: O14976

  • Positive control
    • Human testis tissue and 293 cell lysates.

Properties

Applications

Our Abpromise guarantee covers the use of ab190231 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 20 µg/ml.
WB 1/500 - 1/1000. Predicted molecular weight: 143 kDa.

Target

  • Function
    Associates with cyclin G and CDK5. Seems to act as an auxilin homolog that is involved in the uncoating of clathrin-coated vesicles by Hsc70 in non-neuronal cells. Expression oscillates slightly during the cell cycle, peaking at G1.
  • Tissue specificity
    Ubiquitous. Highest in testis.
  • Sequence similarities
    Belongs to the protein kinase superfamily. Ser/Thr protein kinase family.
    Contains 1 C2 tensin-type domain.
    Contains 1 J domain.
    Contains 1 phosphatase tensin-type domain.
    Contains 1 protein kinase domain.
  • Cellular localization
    Cytoplasm > perinuclear region. Golgi apparatus > trans-Golgi network. Cell junction > focal adhesion. Localizes to the perinuclear area and to the trans-Golgi network. Also seen on the plasma membrane, probably at focals adhesions.
  • Information by UniProt
  • Database links
  • Alternative names
    • Auxilin 2 antibody
    • Cyclin G associated kinase antibody
    • Cyclin-G-associated kinase antibody
    • DNAJ26 antibody
    • DNAJC26 antibody
    • EC 2.7.11.1 antibody
    • FLJ16629 antibody
    • FLJ40395 antibody
    • GAK antibody
    • GAK protein antibody
    • GAK_HUMAN antibody
    • MGC99654 antibody
    see all

Images

  • All lanes : Anti-GAK antibody (ab190231) at 1/500 dilution

    Lane 1 : 293 cell lysate
    Lane 2 : 293 cell lysate with synthesized peptide


    Predicted band size : 143 kDa
  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human testis tissue labeling GAK with ab190231 at 20 µg/ml.

References

ab190231 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab190231.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up