Overview

  • Product nameAnti-GAL3ST4 antibody
    See all GAL3ST4 primary antibodies
  • Description
    Rabbit polyclonal to GAL3ST4
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Mouse
    Predicted to work with: Rat, Rabbit, Horse, Guinea pig, Cow, Cat, Dog, Human
  • Immunogen

    Synthetic peptide corresponding to a region within C terminal amino acids 419-468 (

    RPLQFGSAKVLGYVLQSGLNQKDKEECERLATPELQYKDKLDAKQFPPTV

    ) of Mouse GAL3ST4 (NP_001028588).

  • Positive control
    • Mouse pancreas lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab116039 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 54 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • FunctionCatalyzes the transfer of sulfate to beta-1,3-linked galactose residues in O-linked glycoproteins. Good substrates include asialofetuin, Gal-beta-1,3-GalNAc and Gal-beta-1,3 (GlcNAc-beta-1,6)GalNAc.
  • Tissue specificityExpressed mainly in placenta, thymus, testis, ovary, spinal cord, trachea and adrenal gland and at low levels in brain, lung, spleen, prostate, small intestine, colon, stomach thyroid and lymph node.
  • PathwayProtein modification; carbohydrate sulfation.
  • Sequence similaritiesBelongs to the galactose-3-O-sulfotransferase family.
  • Cellular localizationGolgi apparatus > Golgi stack membrane.
  • Information by UniProt
  • Database links
  • Alternative names
    • 3-GalNAc 3''-sulfotransferase antibody
    • Beta galactose 3 O sulfotransferase, 4 antibody
    • Beta-galactose-3-O-sulfotransferase 4 antibody
    • G3ST4_HUMAN antibody
    • Gal-beta-1 antibody
    • GAL3ST 4 antibody
    • Gal3ST-4 antibody
    • GAL3ST4 antibody
    • Galactose 3 O sulfotransferase 4 antibody
    • Galactose-3-O-sulfotransferase 4 antibody
    see all

Anti-GAL3ST4 antibody images

  • Anti-GAL3ST4 antibody (ab116039) at 1 µg/ml + Mouse pancreas lysate at 10 µg

    Predicted band size : 54 kDa

References for Anti-GAL3ST4 antibody (ab116039)

ab116039 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116039.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"