Overview

  • Product nameAnti-Galanin antibody (Biotin)
    See all Galanin primary antibodies
  • Description
    Rabbit polyclonal to Galanin (Biotin)
  • ConjugationBiotin
  • Tested applicationsSuitable for: IP, RIA, ELISAmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Sheep, Chicken, Cow, Pig, Fish, Macaque Monkey
  • Immunogen

    Synthetic peptide:

    GWTLNSAGYLLGPHAVGNHRSFSDKNGLTS

    conjugated to KLH via carboxyl group, corresponding to amino acids 33-62 of Human Galanin.

Properties

Applications

Our Abpromise guarantee covers the use of ab48258 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IP Use at an assay dependent dilution.
RIA Use at an assay dependent dilution.
ELISA Use at an assay dependent dilution.

Target

References for Anti-Galanin antibody (Biotin) (ab48258)

ab48258 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab48258.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"