Overview

  • Product nameAnti-GALE antibody
    See all GALE primary antibodies
  • Description
    Rabbit polyclonal to GALE
  • SpecificityGALE
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Rat, Rabbit, Horse, Cow, Cat, Dog, Pig
  • Immunogen

    Synthetic peptide corresponding to a region within internal amino acids 201-250 (PQGIPNNLMPYVSQVAIGRREALNVFGNDYDTEDGTGVRDYIHVVDLAK G) of Human GALE (NP_001008217).

  • Positive control
    • 293T cell lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab108173 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.5 µg/ml. Predicted molecular weight: 38 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • FunctionCatalyzes two distinct but analogous reactions: the epimerization of UDP-glucose to UDP-galactose and the epimerization of UDP-N-acetylglucosamine to UDP-N-acetylgalactosamine.
  • PathwayCarbohydrate metabolism; galactose metabolism.
  • Involvement in diseaseDefects in GALE are the cause of epimerase-deficiency galactosemia (EDG) [MIM:230350]; also known as galactosemia type 3. Clinical features include early-onset cataracts, liver damage, deafness and mental retardation. There are two clinically distinct forms of EDG. (1) A benign, or 'peripheral' form with no detectable GALE activity in red blood cells and characterized by mild symptoms. Some patients may suffer no symptoms beyond raised levels of galactose-1-phosphate in the blood. (2) A much rarer 'generalized' form with undetectable levels of GALE activity in all tissues and resulting in severe features such as restricted growth and mental development.
  • Sequence similaritiesBelongs to the sugar epimerase family.
  • Information by UniProt
  • Database links
  • Alternative names
    • FLJ95174 antibody
    • FLJ97302 antibody
    • Galactose 4 epimerase UDP antibody
    • Galactowaldenase antibody
    • galE antibody
    • GALE_HUMAN antibody
    • OTTHUMP00000002991 antibody
    • OTTHUMP00000002994 antibody
    • OTTHUMP00000037931 antibody
    • OTTHUMP00000044857 antibody
    • SDR1E1 antibody
    • short chain dehydrogenase/reductase family 1E member 1 antibody
    • UDP galactose 4 epimerase antibody
    • UDP galactose 4' epimerase antibody
    • UDP glucose 4 epimerase antibody
    • UDP-galactose 4-epimerase antibody
    • UDP-glucose 4-epimerase antibody
    see all

Anti-GALE antibody images

  • Anti-GALE antibody (ab108173) at 0.5 µg/ml + 293T cell lysate at 10 µg

    Predicted band size : 38 kDa

References for Anti-GALE antibody (ab108173)

ab108173 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab108173.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"