Overview

  • Product name
    Anti-GALNTL5 antibody
  • Description
    Rabbit polyclonal to GALNTL5
  • Tested applications
    Suitable for: WB, IHC-Pmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human GALNTL5 aa 253-443. (BC022021).
    Sequence:

    CPLIDVIDDRTLEYKPSPLVRGTFDWNLQFKWDNVFSYEMDGPEGSTKPI RSPAMSGGIFAIRRHYFNEIGQYDKDMDFWGRENLELSLRIWMCGGQLFI IPCSRVGHISKKQTGKPSTIISAMTHNYLRLVHVWLDEYKEQFFLRKPGL KYVTYGNIRERVELRKRLGCKSFQWYLDNVFPELEASVNSL


    Database link: Q7Z4T8

  • Positive control
    • Human testis lysate; Human fetal testis tissue.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 98% PBS, 1% BSA
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab176772 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/200 - 1/1000. Predicted molecular weight: 51 kDa.
IHC-P 1/100 - 1/500.

Target

  • Function
    May catalyze the initial reaction in O-linked oligosaccharide biosynthesis, the transfer of an N-acetyl-D-galactosamine residue to a serine or threonine residue on the protein receptor.
  • Tissue specificity
    Expressed in testis.
  • Pathway
    Protein modification; protein glycosylation.
  • Sequence similarities
    Belongs to the glycosyltransferase 2 family. GalNAc-T subfamily.
  • Domain
    There are two conserved domains in the glycosyltransferase region: the N-terminal domain (domain A, also called GT1 motif), which is probably involved in manganese coordination and substrate binding and the C-terminal domain (domain B, also called Gal/GalNAc-T motif), which is probably involved in catalytic reaction and UDP-Gal binding.
  • Cellular localization
    Golgi apparatus membrane.
  • Information by UniProt
  • Database links
  • Alternative names
    • GalNAc-T15 antibody
    • GALNACT19 antibody
    • GALNT15 antibody
    • GALNTL5 antibody
    • GLTL5_HUMAN antibody
    • Polypeptide GalNAc transferase 15 antibody
    • pp-GaNTase 15 antibody
    • Protein-UDP acetylgalactosaminyltransferase 15 antibody
    • Putative polypeptide N-acetylgalactosaminyltransferase-like protein 5 antibody
    • UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 15 antibody
    • UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase-like 5 antibody
    see all

Images

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human fetal testis tissue labeling GALNTL5 with ab176772 at 1/100 dilution.

  • Anti-GALNTL5 antibody (ab176772) at 1/500 dilution + Human testis lysate

    Predicted band size : 51 kDa

References

ab176772 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab176772.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up