Overview

  • Product name
  • Description
    Rabbit polyclonal to GAMT
  • Tested applications
    Suitable for: IPmore details
    Unsuitable for: WB
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Synthetic peptide within Human GAMT aa 100-150 (internal sequence). The exact sequence is proprietary. (NP_000147.1).
    Sequence:

    RDWAPRQTHKVIPLKGLWEDVAPTLPDGHFDGILYDTYPLSEETWHTHQF N


    Database link: Q14353

  • Positive control
    • Jurkat whole cell lysate.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    Preservative: 0.09% Sodium azide
    Constituent: 99% Tris citrate/phosphate

    pH 7-8
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Purification notes
    ab186040 was affinity purified using an epitope specific to GAMT immobilized on solid support.
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab186040 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IP Use at 2-10 µg/mg of lysate.
  • Application notes
    Is unsuitable for WB.
  • Target

    • Tissue specificity
      Expressed in liver.
    • Pathway
      Amine and polyamine biosynthesis; creatine biosynthesis; creatine from L-arginine and glycine: step 2/2.
    • Involvement in disease
      Defects in GAMT are the cause of guanidinoacetate methyltransferase deficiency (GAMT deficiency) [MIM:612736]. GAMT deficiency is an autosomal recessive disorder characterized by developmental delay/regression, mental retardation, severe disturbance of expressive and cognitive speech, intractable seizures and movement disturbances, severe depletion of creatine/phosphocreatine in the brain, and accumulation of guanidinoacetic acid (GAA) in brain and body fluids.
    • Sequence similarities
      Belongs to the RMT2 methyltransferase family.
    • Information by UniProt
    • Database links
    • Alternative names
      • CCDS2 antibody
      • Epididymis secretory protein Li 20 antibody
      • GAMT antibody
      • GAMT_HUMAN antibody
      • Guanidinoacetate N methyltransferase antibody
      • Guanidinoacetate N-methyltransferase antibody
      • HEL-S-20 antibody
      • PIG2 antibody
      • TP53I2 antibody
      see all

    Images

    • Detection of GAMT by Western Blot of Immunprecipitate.

      Lane 1: Jurkat whole cell lysate immunoprecipitated using ab186040 at 6 µg/mg lysate (1 mg/IP; 20% of IP loaded/lane).

      Lane 2: Jurkat whole cell lysate immunoprecipitated using a Control IgG

       

      An alternative anti-GAMT antibody was used at 1 µg/ml for subsequent western blot detection.
      Detection: Chemiluminescence with exposure time of 10 seconds.

       

    References

    ab186040 has not yet been referenced specifically in any publications.

    Customer reviews and Q&As

    There are currently no Customer reviews or Questions for ab186040.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

    Sign up