Overview

  • Product name
  • Description
    Rabbit polyclonal to GC1q R
  • Host species
    Rabbit
  • Tested applications
    Suitable for: ICC/IF, IHC-P, WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment (His-tag) corresponding to Human GC1q R aa 76-282. (Expressed in E.coli).
    Sequence:

    TDGDKAFVDFLSDEIKEERKIQKHKTLPKMSGGWELELNGTEAKLVRKVA GEKITVTFNINNSIPPTFDGEEEPSQGQKVEEQEPELTSTPNFVVEVIKN DDGKKALVLDCHYPEDEVGQEDEAESDIFSIREVSFQSTGESEWKDTNYT LNTDSLDWALYDHLMDFLADRGVDNTFADELVELSTALEHQEYITFLEDL KSFVKSQ


    Database link: Q07021

  • Positive control
    • IHC-P: Human lung cancer, prostate gland cancer, kidney and rectum cancer tissues. ICC/IF: HeLa cells. WB: K562 and HeLa cell lysates; Human liver lysate; Recombinant human GC1q R protein.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    pH: 7.40
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Purification notes
    ab232712 was purified by antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab232712 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 5 - 20 µg/ml.
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.5 - 5 µg/ml. Predicted molecular weight: 31 kDa.

Target

  • Function
    Binds to the globular "heads" of C1Q thus inhibiting C1 activation.
  • Sequence similarities
    Belongs to the MAM33 family.
  • Cellular localization
    Mitochondrion matrix. Nucleus. Might also be nuclear in some cell types.
  • Information by UniProt
  • Database links
  • Alternative names
    • ASF/SF2 associated protein p32 antibody
    • C1q globular domain binding protein antibody
    • C1qBP antibody
    • C1QBP_HUMAN antibody
    • Complement component 1 q subcomponent binding protein antibody
    • Complement component 1 Q subcomponent binding protein mitochondrial antibody
    • Complement component 1 Q subcomponent-binding protein, mitochondrial antibody
    • GC1Q R antibody
    • GC1q R protein antibody
    • GC1q-R protein antibody
    • GC1QBP antibody
    • GC1QR antibody
    • globular domain of, C1q, receptor for antibody
    • Glycoprotein gC1qBP antibody
    • HABP 1 antibody
    • HABP1 antibody
    • Hyaluronan binding protein 1 antibody
    • Hyaluronan-binding protein 1 antibody
    • Mitochondrial matrix protein p32 antibody
    • p32 antibody
    • p32 splicing factor antibody
    • p33 antibody
    • Pre mrna splicing factor SF2 P32 subunit precursor antibody
    • SF2p32 antibody
    • Splicing factor SF2 associated protein antibody
    see all

Images

  • Paraffin-embedded human lung cancer tissue stained for GC1q R using ab232712 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded human prostate gland cancer tissue stained for GC1q R using ab232712 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded human kidney tissue stained for GC1q R using ab232712 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded human rectum cancer tissue stained for GC1q R using ab232712 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • HeLa (human epithelial cell line from cervix adenocarcinoma) cells stained for GC1q R (green) using ab232712 at 20 µg/ml in ICC/IF, followed FITC staining.

  • Anti-GC1q R antibody (ab232712) at 3 µg/ml + Recombinant human GC1q R protein

    Secondary
    HRP-Linked Guinea pig Anti-Rabbit at 1/2000 dilution

    Predicted band size: 31 kDa

  • All lanes : Anti-GC1q R antibody (ab232712) at 3 µg/ml

    Lane 1 : K562 (human chronic myelogenous leukemia cell line from bone marrow) cell lysate
    Lane 2 : HeLa (epithelial cell line from cervix adenocarcinoma) cell lysate
    Lane 3 : Human liver lysate

    Secondary
    All lanes : HRP-Linked Guinea pig Anti-Rabbit at 1/2000 dilution

    Predicted band size: 31 kDa

References

ab232712 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab232712.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up