Overview

  • Product name
    Anti-Genethonin 1 antibody
    See all Genethonin 1 primary antibodies
  • Description
    Rabbit polyclonal to Genethonin 1
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Full length protein corresponding to Human Genethonin 1 aa 1-358.
    Sequence:

    MGAVWSALLVGGGLAGALFVWLLRGGPGDTGKDGDAEQEKDAPLGGAAIP GGHQSGSSGLSPGPSGQELVTKPEHLQESNGHLISKTKDLGKLQAASWRL QNPSREVCDNSREHVPSGQFPDTEAPATSETSNSRSYSEVSRNESLESPM GEWGFQKGQEISAKAATCFAEKLPSSNLLKNRAKEEMSLSDLNSQDRVDH EEWEMVPRHSSWGDVGVGGSLKAPVLNLNQGMDNGRSTLVEARGQQVHGK MERVAVMPAGSQQVSVRFQVHYVTSTDVQFIAVTGDHECLGRWNTYIPLH YNKDGFWSHSIFLPADTVVEWKFVLVENGGVTRWEECSNRFLETGHEDKV VHAWWGIH


    Database link: NP_003934.1

  • Positive control
    • Genethonin 1 transfected 293T cell lysate.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    pH: 7.20
    Constituent: PBS
  • Concentration information loading...
  • Purity
    Protein A purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab172352 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 39 kDa.

Target

  • Function
    May have the capability to bind to carbohydrates.
  • Tissue specificity
    Expressed at high level in skeletal and cardiac muscles. Moderately expressed in liver and placenta. No expression is found in pancreas, kidney or lung. Present in skeletal muscle, heart and placenta (at protein level).
  • Sequence similarities
    Contains 1 CBM20 (carbohydrate binding type-20) domain.
  • Cellular localization
    Membrane. Distributed in the transverse tubules and/or near the junctional sarcoplasmic reticulum.
  • Information by UniProt
  • Database links
  • Alternative names
    • FLJ41801 antibody
    • Genethonin-1 antibody
    • Genethonin1 antibody
    • GENEX 3414 antibody
    • GENEX3414 antibody
    • GENX 3414 antibody
    • GENX3414 antibody
    • Starch binding domain 1 antibody
    • Starch binding domain containing protein 1 antibody
    • Starch-binding domain-containing protein 1 antibody
    • STBD 1 antibody
    • STBD1 antibody
    • STBD1_HUMAN antibody
    see all

Images

  • All lanes : Anti-Genethonin 1 antibody (ab172352) at 1 µg/ml

    Lane 1 : Genethonin 1 transfected 293T cell lysate
    Lane 2 : Non-transfected 293T cell lysate

    Lysates/proteins at 15 µl per lane.

    Secondary
    All lanes : Goat Anti-Rabbit IgG (H+L), peroxidase conjugate at 1/7500 dilution

    Predicted band size: 39 kDa

References

ab172352 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab172352.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up