Overview

  • Product nameAnti-GFP antibody (FITC)See all GFP primary antibodies ...
  • Description
    Goat polyclonal to GFP (FITC)
  • ConjugationFITC. Ex: 493nm, Em: 528nm
  • Conjugation notesFluorescein isothiocyanate (FITC) (MW 390 daltons) Absorption Wavelength: 495 nm Emission Wavelength: 528 nm Fluorochrome/Protein Ratio: 3.5 moles FITC per mole of Goat IgG
  • SpecificityAssay by immunoelectrophoresis resulted in a single precipitin arc against anti-Goat Serum, anti-Fluorescein and purified and partially purified Green Fluorescent Protein (Aequorea victoria). No reaction was observed against Human, Mouse and Rat Serum Proteins.
  • Tested applicationsIHC-FoFr, IHC-P, IHC-Fr, WB, ICC/IFmore details
  • Immunogen

    Recombinant full length protein corresponding to GFP aa 1-246.
    Sequence:

    MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTT GKLPVPWPTL VTTFSYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRA EVKFEGDTLV NRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHN IEDGSVQLAD HYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGIT HGMDELYK

  • General notes

     

    Designed to detect GFP and its variants in ELISA (sandwich or capture), immunoblotting and immunoprecipitation. Fluorescein conjugated anti-GFP was assayed by immunofluorescence microscopy on prokaryotic (E.coli) and eukaryotic (CHO cells) expression systems and was shown to detect GFP containing inserts. Significant amplification of signal was detected using fluorochrome conjugated anti-GFP relative to the fluorescence of GFP alone.

Properties

  • FormLiquid
  • Storage instructionsStore at +4°C. Store In the Dark.
  • Storage bufferpH: 7.20
    Preservative: 0.01% Sodium azide
    Constituents: 0.42% Potassium phosphate, 0.87% Sodium chloride, 1% BSA

    BSA Immunoglobulin and Protease free
  • Concentration information loading...
  • PurityProtein G purified
  • Purification notesGFP Fluorescein Conjugated Antibody was prepared from monospecific antiserum by immunoaffinity chromatography using Green Fluorescent Protein (Aequorea victoria) coupled to agarose beads followed by solid phase adsorption(s) to remove any unwanted reactivities.
  • Primary antibody notes Designed to detect GFP and its variants in ELISA (sandwich or capture), immunoblotting and immunoprecipitation. Fluorescein conjugated anti-GFP was assayed by immunofluorescence microscopy on prokaryotic (E.coli) and eukaryotic (CHO cells) expression systems and was shown to detect GFP containing inserts. Significant amplification of signal was detected using fluorochrome conjugated anti-GFP relative to the fluorescence of GFP alone.
  • Clonality Polyclonal
  • IsotypeIgG
  • Research Areas

Applications

Our Abpromise guarantee covers the use of ab6662 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-FoFr 1/250.
IHC-P Use at an assay dependent concentration.
IHC-Fr Use at an assay dependent concentration.
WB 1/10000 - 1/100000.
ICC/IF 1/200 - 1/400.

Target

  • RelevanceFunction: Energy-transfer acceptor. Its role is to transduce the blue chemiluminescence of the protein aequorin into green fluorescent light by energy transfer. Fluoresces in vivo upon receiving energy from the Ca2+ -activated photoprotein aequorin.

    Subunit structure: Monomer.

    Tissue specificity: Photocytes.

    Post-translational modification: Contains a chromophore consisting of modified amino acid residues. The chromophore is formed by autocatalytic backbone condensation between Ser-65 and Gly-67, and oxidation of Tyr-66 to didehydrotyrosine. Maturation of the chromophore requires nothing other than molecular oxygen.

    Biotechnological use: Green fluorescent protein has been engineered to produce a vast number of variously colored mutants, fusion proteins, and biosensors. Fluorescent proteins and its mutated allelic forms, blue, cyan and yellow have become a useful and ubiquitous tool for making chimeric proteins, where they function as a fluorescent protein tag. Typically they tolerate N- and C-terminal fusion to a broad variety of proteins. They have been expressed in most known cell types and are used as a noninvasive fluorescent marker in living cells and organisms. They enable a wide range of applications where they have functioned as a cell lineage tracer, reporter of gene expression, or as a measure of protein-protein interactions. Can also be used as a molecular thermometer, allowing accurate temperature measurements in fluids. The measurement process relies on the detection of the blinking of GFP using fluorescence correlation spectroscopy.

    Sequence similarities: Belongs to the GFP family.

    Biophysicochemical properties: Absorption: Abs(max)=395 nm
    Exhibits a smaller absorbance peak at 470 nm. The fluorescence emission spectrum peaks at 509 nm with a shoulder at 540 nm.
  • Alternative names
    • GFP antibody
    • Green Fluorescent Protein antibody
    • yfp antibody

Anti-GFP antibody (FITC) images

  • Immunofluorescence Microscopy using ab6658. Tissue: Drosophila melanogaster late stage embryonic central nervous system. Fixation: 0.5% PFA. Antigen retrieval: not required. Primary antibody: Anti-GFP antibody at a 1/1,000 for 1 h at RT. Secondary antibody: AlexaFluor 488™ conjugated anti-Goat antibody at 1/300 for 45 min at RT. Panel A: shows a lateral view (ventral left). Panels B and C: shows ventral views of whole mount embryos at 63x magnification (plus 2x digital zoom). In all panels, anterior is up. Staining: tau-GFP cell bodies (large arrowhead) and axons of motorneurons (arrow) and interneurons (small arrowhead) as green fluorescent signal.

  • Immunofluorescence Microscopy using ab6658. Tissue: Sf-1:Cre mice crossed to the Z/EG reporter line. Mouse brain (coronal view, 20X magnification). Fixation: 4%PFA/PBS with o/n fixation, and subsequently transferred to a 30% sucrose solution.Antigen retrieval: frozen in OCT freezing medium (Sakura) and cryostat sectioned at 40 microns. Primary antibody: Goat anti- GFP was used at 1/500 dilution in free floating imunnohistochemistry to detect GFP. Secondary antibody: Fluorchrome conjugated Anti-goat IgG secondary antibody was used for detection at 1:500 at 1/10,000 for 45 min at RT.Localization: Sf-1+ neurons and their processes of the ventromedial nucleus of the hypothalamus. Staining: eGFP as green fluorescent signal and sections were counterstained with DAPI.

  • These pictures show confocal immunofluorescence using GFP-expressing glial cells (green) transplanted into the lesioned rat spinal cord. This was detected using ab6662 and a standard FITC filter set. Axons are labelled red by an antibody to neurofilament-200 and a rhodamine secondary antibody. The upper panel shows the centre of the transplant site at low power. Numerous GFP-positive cells can be seen mingling with axons. The lower panel shows, at high power in a single optical section, how ab6662 reveals the morphology of the transplanted cells to such an extent that their close interactions with axons are obvious - the cell depicted can be seen wrapping around a neurofilament-200 positive axon.

    These images were kindly supplied as part of the review submitted by Andrew Toft.

  • Anti-GFP antibody (FITC) (ab6662) + Active A. victoria GFP full length protein (ab84191)

    Western Blot of ab6662. Load: 50 ng per lane. Secondary antibody: Fluorescein goat secondary antibody at 1/1,000 for 60 min at RT. Block: MB-070 for 30 min at

    RT.

  • ab6662 staining mouse brain tissue sections (inducible GFP reporter) by IHC-Fr. The tissue was paraformaldehyde fixed and blocked with serum and then incubated with the antibody at a 1/1000 dilution for 1 hour.

    Staining is shown in the left hand panel. The middle panel shows staining with a rabbit anti-GFP antibody and the right hand panel shows the merged images (plus DAPI). ab6662 gives no noticable background and it is found that when viewing on an epifluorescent the exposure time is significantly reduced.

    See Abreview

References for Anti-GFP antibody (FITC) (ab6662)

This product has been referenced in:
  • Marion-Poll L  et al. Fluorescence-activated sorting of fixed nuclei: a general method for studying nuclei from specific cell populations that preserves post-translational modifications. Eur J Neurosci 39:1234-44 (2014). Flow Cyt . Read more (PubMed: 24713002) »
  • Bausek N & Zeidler MP Ga73B is a downstream effector of JAK/STAT signalling and a regulator of Rho1 in Drosophila haematopoiesis. J Cell Sci 127:101-10 (2014). IHC . Read more (PubMed: 24163435) »

See all 26 Publications for this product

Product Wall

Abcam guarantees this product to work in the species/application used in this Abreview.
Application Immunohistochemistry (Frozen sections)
Sample Mouse Tissue sections (Intestine)
Specification Intestine
Fixative Paraformaldehyde
Permeabilization No
Blocking step BSA as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5%
Username

Abcam user community

Verified customer

Submitted Dec 18 2012

Ab6662 n’a effectivement pas encore été testé en cytométrie en flux et nous n’offrons pas d’échantillon gratuit à des fins de tests préliminaires. Cependant, si vous souhaitez tester ce...

Read More
Abcam guarantees this product to work in the species/application used in this Abreview.
Application Immunocytochemistry/ Immunofluorescence
Sample Mouse Cell (Intestine)
Specification Intestine
Fixative Paraformaldehyde
Permeabilization No
Blocking step BSA as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 23°C
Username

Abcam user community

Verified customer

Submitted Apr 17 2012

ab6662 is directly conjugated to the FITC molecule, thus there is no secondary antibody present. The FITC molecule is attached directly to the Fc portion of the antibody via covalent bonds to amine groups. The FITC is not irreversibly attached to the a...

Read More
Abcam guarantees this product to work in the species/application used in this Abreview.
Application Immunocytochemistry/ Immunofluorescence
Sample African Green Monkey Cell (COS-7)
Specification COS-7
Fixative Paraformaldehyde
Permeabilization Yes - Methanol, 30 min at -20°C
Blocking step FCS as blocking agent for 30 minute(s) · Concentration: 20% · Temperature: RT°C
Username

Dr. Ioannis Gavvovidis

Verified customer

Submitted Dec 09 2010

Abcam guarantees this product to work in the species/application used in this Abreview.
Application Immunohistochemistry (PFA perfusion fixed frozen sections)
Sample Mouse Tissue sections (brain)
Specification brain
Fixative Paraformaldehyde
Antigen retrieval step None
Permeabilization No
Blocking step Commercially available blocking buffer as blocking agent for 30 minute(s) · Concentration: 0.5% · Temperature: 25°C
Username

Abcam user community

Verified customer

Submitted Jan 07 2008

Abcam guarantees this product to work in the species/application used in this Abreview.
Application Immunohistochemistry (Frozen sections)
Sample Mouse Tissue sections (Brain and spinal cord)
Specification Brain and spinal cord
Fixative Methanol
Permeabilization Yes - 0.1% Triton X100
Blocking step BSA as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 2.5% · Temperature: 25°C
Username

Dr. Joshua Weiner

Verified customer

Submitted Jul 06 2007

Abcam guarantees this product to work in the species/application used in this Abreview.
Application Immunohistochemistry (Frozen sections)
Sample Mouse Tissue sections (Inducible GFP reporter (Brain))
Specification Inducible GFP reporter (Brain)
Fixative Paraformaldehyde
Blocking step Serum as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 30 ul/ml
Username

Dr. Joshua Breunig

Verified customer

Submitted Feb 09 2007

Thank you for your enquiry and patience. This GFP antibody will cross react with YFP, CFP, eGFP, but not RFP. Please contact us again if you have any additional questions.

Abcam guarantees this product to work in the species/application used in this Abreview.
Application Immunocytochemistry/ Immunofluorescence
Sample Mouse Cell (tissue whole mount)
Specification tissue whole mount
Fixative Paraformaldehyde
Username

Mr. Noah Druckenbrod

Verified customer

Submitted Mar 21 2006

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"