HRP Anti-GFP antibody (ab6663)
Key features and details
- HRP Goat polyclonal to GFP
- Suitable for: WB
- Reacts with: Species independent
- Conjugation: HRP
- Isotype: IgG
Get better batch-to-batch reproducibility with a recombinant antibody
- Research with confidence – consistent and reproducible results with every batch
- Long-term and scalable supply – powered by recombinant technology for fast production
- Success from the first experiment – confirmed specificity through extensive validation
- Ethical standards compliant – production is animal-free
Overview
-
Product name
HRP Anti-GFP antibody
See all GFP primary antibodies -
Description
HRP Goat polyclonal to GFP -
Host species
Goat -
Conjugation
HRP -
Tested applications
Suitable for: WBmore details -
Species reactivity
Reacts with: Species independent -
Immunogen
Recombinant full length protein corresponding to GFP aa 1-246.
Sequence:MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTT GKLPVPWPTL VTTFSYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRA EVKFEGDTLV NRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHN IEDGSVQLAD HYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGIT HGMDELYK
Database link: P42212 -
Positive control
- GFP
-
General notes
Designed to detect GFP and its variants in ELISA (sandwich or capture), immunoblotting and immunoprecipitation Peroxidase conjugated anti-GFP assayed by immunoblot shows a 42 kDa band when reacted with GFP on a western blot.
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.
If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C. -
Storage buffer
pH: 6.50
Preservative: 0.01% Gentamicin sulphate
Constituents: 0.42% Tripotassium orthophosphate, 0.87% Sodium chloride, 1% BSA
Do NOT add Sodium Azide! -
Concentration information loading...
-
Purity
Affinity purified -
Purification notes
This product was prepared from monospecific antiserum by immunoaffinity chromatography using Green Fluorescent Protein (Aequorea victoria) coupled to agarose beads followed by solid phase adsorption(s) to remove any unwanted reactivities. -
Primary antibody notes
Designed to detect GFP and its variants in ELISA (sandwich or capture), immunoblotting and immunoprecipitation Peroxidase conjugated anti-GFP assayed by immunoblot shows a 42 kDa band when reacted with GFP on a western blot. -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Recombinant Protein
-
Related Products
- TMB ELISA Substrate (Highest Sensitivity) (ab171522)
- TMB ELISA Substrate (High Sensitivity) (ab171523)
- TMB ELISA Substrate (Fast Kinetic Rate) (ab171524)
- TMB ELISA Substrate (Slow Kinetic Rate) (ab171525)
- TMB ELISA Substrate (Slower Kinetic Rate) (ab171526)
- TMB ELISA Substrate (Slowest Kinetic Rate) (ab171527)
- 450 nm Stop Solution for TMB Substrate (ab171529)
- 650 nm Stop Solution for TMB Substrate (ab171531)
- Immunoassay Blocking Buffer (ab171534)
- Immunoassay Blocking (BSA Free) (ab171535)
- GFP ELISA Kit (ab171581)
Applications
The Abpromise guarantee
Our Abpromise guarantee covers the use of ab6663 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB |
1/2000 - 1/5000.
|
Notes |
---|
WB
1/2000 - 1/5000. |
Target
-
Relevance
Function: Energy-transfer acceptor. Its role is to transduce the blue chemiluminescence of the protein aequorin into green fluorescent light by energy transfer. Fluoresces in vivo upon receiving energy from the Ca2+ -activated photoprotein aequorin.
Subunit structure: Monomer.
Tissue specificity: Photocytes.
Post-translational modification: Contains a chromophore consisting of modified amino acid residues. The chromophore is formed by autocatalytic backbone condensation between Ser-65 and Gly-67, and oxidation of Tyr-66 to didehydrotyrosine. Maturation of the chromophore requires nothing other than molecular oxygen.
Biotechnological use: Green fluorescent protein has been engineered to produce a vast number of variously colored mutants, fusion proteins, and biosensors. Fluorescent proteins and its mutated allelic forms, blue, cyan and yellow have become a useful and ubiquitous tool for making chimeric proteins, where they function as a fluorescent protein tag. Typically they tolerate N- and C-terminal fusion to a broad variety of proteins. They have been expressed in most known cell types and are used as a noninvasive fluorescent marker in living cells and organisms. They enable a wide range of applications where they have functioned as a cell lineage tracer, reporter of gene expression, or as a measure of protein-protein interactions. Can also be used as a molecular thermometer, allowing accurate temperature measurements in fluids. The measurement process relies on the detection of the blinking of GFP using fluorescence correlation spectroscopy.
Sequence similarities: Belongs to the GFP family.
Biophysicochemical properties: Absorption: Abs(max)=395 nm
Exhibits a smaller absorbance peak at 470 nm. The fluorescence emission spectrum peaks at 509 nm with a shoulder at 540 nm. -
Alternative names
- GFP antibody
- Green fluorescent protein antibody
Datasheets and documents
-
Datasheet download
References (42)
ab6663 has been referenced in 42 publications.
- Yee M et al. Neonatal Hyperoxia Activates Activating Transcription Factor 4 to Stimulate Folate Metabolism and Alveolar Epithelial Type 2 Cell Proliferation. Am J Respir Cell Mol Biol 66:402-414 (2022). PubMed: 35045271
- Aragonés V et al. Simplifying plant gene silencing and genome editing logistics by a one-Agrobacterium system for simultaneous delivery of multipartite virus vectors. Biotechnol J 17:e2100504 (2022). PubMed: 35332696
- Yang X et al. Overexpression of GmGAMYB Accelerates the Transition to Flowering and Increases Plant Height in Soybean. Front Plant Sci 12:667242 (2021). PubMed: 34040624
- Cheng M et al. Lanthanum(III) triggers AtrbohD- and jasmonic acid-dependent systemic endocytosis in plants. Nat Commun 12:4327 (2021). PubMed: 34267202
- Berndt AJ et al. Recombinant production of a functional SARS-CoV-2 spike receptor binding domain in the green algae Chlamydomonas reinhardtii. PLoS One 16:e0257089 (2021). PubMed: 34793485