Overview

  • Product nameAnti-GHRHR antibody
    See all GHRHR primary antibodies
  • Description
    Rabbit polyclonal to GHRHR
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Rat, Rabbit, Horse, Cat, Dog
  • Immunogen

    Synthetic peptide corresponding to a region within internal amino acids 107-156 (

    PYPVACPVPLELLAEEESYFSTVKIIYTVGHSISIVALFVAITILVALRR

    ) of Human GHRHR (NP_001009824).

  • Positive control
    • PANC1 cell lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab98027 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 47 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • FunctionReceptor for GRF, coupled to G proteins which activate adenylyl cyclase. Stimulates somatotroph cell growth, growth hormone gene transcription and growth hormone secretion.
  • Tissue specificityPituitary gland.
  • Involvement in diseaseDefects in GHRHR are a cause of growth hormone deficiency isolated type 1B (IGHD1B) [MIM:612781]; also known as dwarfism of Sindh. IGHD1B is an autosomal recessive deficiency of GH which causes short stature. IGHD1B patients have low but detectable levels of GH.
  • Sequence similaritiesBelongs to the G-protein coupled receptor 2 family.
  • Cellular localizationCell membrane.
  • Information by UniProt
  • Database links
  • Alternative names
    • GHRFR antibody
    • GHRH R antibody
    • GHRH receptor antibody
    • Ghrhr antibody
    • GHRHR_HUMAN antibody
    • GHRHRpsv antibody
    • GRF R antibody
    • GRF receptor antibody
    • GRFR antibody
    • Growth hormone releasing factor receptor antibody
    • Growth hormone releasing hormone receptor antibody
    • Growth hormone-releasing factor receptor antibody
    • Growth hormone-releasing hormone receptor antibody
    see all

Anti-GHRHR antibody images

  • Anti-GHRHR antibody (ab98027) at 1 µg/ml (in 5% skim milk / PBS buffer) + PANC1 cell lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 47 kDa

References for Anti-GHRHR antibody (ab98027)

ab98027 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab98027.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"