Overview

  • Product nameAnti-GJB3 antibody
    See all GJB3 primary antibodies
  • Description
    Rabbit polyclonal to GJB3
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Mouse
    Predicted to work with: Rat, Zebrafish
  • Immunogen

    Synthetic peptide, corresponding to a region within N terminal amino acids 1-50 (

    MDWKKLQDLLSGVNQYSTAFGRIWLSVVFVFRVLVYVVAAERVWGDEQKD

    ) of Mouse GJB3 (NP_032152.1).

  • Positive control
    • SP2/0 cell lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab108285 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.125 µg/ml. Predicted molecular weight: 31 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • FunctionOne gap junction consists of a cluster of closely packed pairs of transmembrane channels, the connexons, through which materials of low MW diffuse from one cell to a neighboring cell.
  • Involvement in diseaseDefects in GJB3 are a cause of erythrokeratodermia variabilis (EKV) [MIM:133200]. EKV is a genodermatosis characterized by the appearance of two independent skin lesions: transient figurate erythematous patches and hyperkeratosis that is usually localized but occasionally occurs in its generalized form. Clinical presentation varies significantly within a family and from one family to another. Palmoplantar keratoderma is present in around 50% of cases.
    Defects in GJB3 are the cause of deafness autosomal dominant type 2B (DFNA2B) [MIM:612644]. DFNA2 is a form of sensorineural hearing loss. Sensorineural deafness results from damage to the neural receptors of the inner ear, the nerve pathways to the brain, or the area of the brain that receives sound information.
  • Sequence similaritiesBelongs to the connexin family. Beta-type (group I) subfamily.
  • Cellular localizationCell membrane. Cell junction > gap junction.
  • Information by UniProt
  • Database links
  • Alternative names
    • Connexin 31 antibody
    • Connexin-31 antibody
    • Connexin31 antibody
    • CX 31 antibody
    • Cx31 antibody
    • CXB3_HUMAN antibody
    • DFNA 2 antibody
    • DFNA2 antibody
    • DFNA2B antibody
    • EKV antibody
    • FLJ22486 antibody
    • Gap junction beta 3 protein antibody
    • Gap junction beta-3 protein antibody
    • Gap junction protein beta 3 31kDa antibody
    • Gap junction protein beta 3 antibody
    • GJB 3 antibody
    • Gjb3 antibody
    • MGC102938 antibody
    see all

Anti-GJB3 antibody images

  • Anti-GJB3 antibody (ab108285) at 0.125 µg/ml + SP2/0 cell lysate at 10 µg

    Predicted band size : 31 kDa

References for Anti-GJB3 antibody (ab108285)

ab108285 has not yet been referenced specifically in any publications.

Product Wall

Abcam has not validated the combination of species/application used in this Abreview.
Application Immunohistochemistry (Frozen sections)
Sample Mouse Tissue sections (E14.5 wildtype gut)
Specification E14.5 wildtype gut
Fixative Formaldehyde
Permeabilization Yes - 0.1% Triton X-100
Blocking step Serum as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 1% · Temperature: 25°C
Username

Abcam user community

Verified customer

Submitted Jul 19 2012

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"