Overview

  • Product name
  • Description
    Rabbit polyclonal to GJC2
  • Tested applications
    Suitable for: WB, IHC-Pmore details
  • Species reactivity
    Reacts with: Mouse, Rat, Human
  • Immunogen

    Recombinant full length protein corresponding to Human GJC2 aa 1-439.
    Sequence:

    MTNMSWSFLTRLLEEIHNHSTFVGKVWLTVLVVFRIVLTAVGGEAIYSDE QAKFTCNTRQPGCDNVCYDAFAPLSHVRFWVFQIVVISTPSVMYLGYAVH RLARASEQERRRALRRRPGPRRAPRAHLPPPHAGWPEPADLGEEEPMLGL GEEEEEEETGAAEGAGEEAEEAGAEEACTKAVGADGKAAGTPGPTGQHDG RRRIQREGLMRVYVAQLVARAAFEVAFLVGQYLLYGFEVRPFFPCSRQPC PHVVDCFVSRPTEKTVFLLVMYVVSCLCLLLNLCEMAHLGLGSAQDAVRG RRGPPASAPAPAPRPPPCAFPAAAAGLACPPDYSLVVRAAERARAHDQNL ANLALQALRDGAAAGDRDRDSSPCVGLPAASRGPPRAGAPASRTGSATSA GTVGEQGRPGTHERPGAKPRAGSEKGSASSRDGKTTVWI


    Database link: Q5T442

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    Preservative: 0.1% Sodium azide
    Constituents: 50% Glycerol, 49% PBS
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Purification notes
    ab192502 was affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific immunogen and the purity is > 95% (by SDS-PAGE).
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab192502 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use at an assay dependent concentration. Predicted molecular weight: 47 kDa.
IHC-P Use at an assay dependent concentration.

Target

  • Function
    One gap junction consists of a cluster of closely packed pairs of transmembrane channels, the connexons, through which materials of low MW diffuse from one cell to a neighboring cell. May play a role in myelination in central and peripheral nervous systems.
  • Tissue specificity
    Expressed in central nervous system, in sciatic nerve and sural nerve. Also detected in skeletal muscles.
  • Involvement in disease
    Defects in GJC2 are the cause of leukodystrophy hypomyelinating type 2 (HLD2) [MIM:608804]; also known as Pelizaeus-Merzbacher-like disease autosomal recessive type 1. HLD2 is an autosomal recessive hypomyelinating leukodystrophy characterized by nystagmus, impaired motor development, ataxia, choreoathetotic movements, dysarthria and progressive spasticity.
    Defects in GJC2 are the cause of spastic paraplegia autosomal recessive type 44 (SPG44) [MIM:613206]. A form of spastic paraplegia, a neurodegenerative disorder characterized by a slow, gradual, progressive weakness and spasticity of the lower limbs. Rate of progression and the severity of symptoms are quite variable. Initial symptoms may include difficulty with balance, weakness and stiffness in the legs, muscle spasms, and dragging the toes when walking. In some forms of the disorder, bladder symptoms (such as incontinence) may appear, or the weakness and stiffness may spread to other parts of the body.
    Defects in GJC2 are the cause of lymphedema hereditary type 1C (LMPH1C) [MIM:613480]. LMPH1C is a chronic disabling condition which results in swelling of the extremities due to altered lymphatic flow. Patients with lymphedema suffer from recurrent local infections and physical impairment.
  • Sequence similarities
    Belongs to the connexin family. Gamma-type subfamily.
  • Cellular localization
    Cell membrane. Cell junction > gap junction.
  • Information by UniProt
  • Database links
  • Alternative names
    • B230382L12Rik antibody
    • Connexin 46.6 antibody
    • Connexin 47 antibody
    • Connexin-46.6 antibody
    • Connexin-47 antibody
    • Connexin46.6 antibody
    • Connexin47 antibody
    • CX 46.6 antibody
    • Cx 47 antibody
    • Cx46.6 antibody
    • Cx47 antibody
    • CXG2_HUMAN antibody
    • Gap junction alpha 12 protein antibody
    • Gap junction alpha-12 protein antibody
    • Gap junction gamma 2 protein antibody
    • Gap junction gamma-2 protein antibody
    • Gap junction protein alpha 12 47kDa antibody
    • Gap junction protein gamma 2 47kDa antibody
    • GAP JUNCTION PROTEIN, 47-KD antibody
    • gap junction protein, gamma 12, 47kDa antibody
    • gap junction protein, gamma 2, 47kDa antibody
    • GJA 12 antibody
    • GJA12 antibody
    • GJC 2 antibody
    • Gjc2 antibody
    • HLD 2 antibody
    • HLD2 antibody
    • LMPH1C antibody
    • MGC105119 antibody
    • MGC130506 antibody
    • OTTHUMP00000037763 antibody
    • PMLDAR antibody
    • SPG44 antibody
    see all

References

ab192502 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab192502.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up