• Product nameAnti-GLE1 antibody
    See all GLE1 primary antibodies
  • Description
    Rabbit polyclonal to GLE1
  • Tested applicationsSuitable for: WB, ELISAmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Horse, Chicken, Cow, Cat, Dog, Pig, Saccharomyces cerevisiae
  • Immunogen

    Synthetic peptide corresponding to a region within N terminal ammino acids 217-266 (LKLREAEQQRVKQAEQERLRKEEGQIRLRALYALQEEMLQLSQQLDASE Q) of human GLE1 (NP_001490).

  • Positive control
    • Placenta lysate



Our Abpromise guarantee covers the use of ab81648 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 80 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.
ELISA Use at an assay dependent concentration.

ELISA titre using peptide based assay: 1/1562500.


  • FunctionRequired for the export of mRNAs containing poly(A) tails from the nucleus into the cytoplasm. May be involved in the terminal step of the mRNA transport through the nuclear pore complex (NPC).
  • Involvement in diseaseDefects in GLE1 are the cause of lethal congenital contracture syndrome type 1 (LCCS1) [MIM:253310]; also known as multiple contracture syndrome type Finnish. LCCS is an autosomal recessive disorder characterized by early fetal hydrops and akinesia, micrognatia, pulmonary hypoplasia, pterygia, multiple joint contractures, specific neuropathology with degeneration of anterior horn neurons and extreme skeletal muscle atrophy. LCCS1 leads to prenatal death.
    Defects in GLE1 are the cause of lethal arthrogryposis with anterior horn cell disease (LAAHD) [MIM:611890]. LAAHD is characterized by fetal akinesia, arthrogryposis and motor neuron loss. LAADH fetus often survive delivery, but die early as a result of respiratory failure. Neuropathological findings resemble those of LCCS1, but are less severe.
  • Sequence similaritiesBelongs to the GLE1 family.
  • Cellular localizationNucleus. Cytoplasm. Shuttles between the nucleus and the cytoplasm. Shuttling is essential for its mRNA export function and Cytoplasm. Nucleus > nuclear pore complex. Shuttles between the nucleus and the cytoplasm. In the nucleus, isoform 1 localizes to the nuclear pore complex and nuclear envelope. Shuttling is essential for its mRNA export function.
  • Information by UniProt
  • Database links
  • Alternative names
    • GLE 1 antibody
    • GLE1 antibody
    • GLE1 like protein antibody
    • GLE1 like RNA export mediator antibody
    • GLE1 RNA export mediator homolog antibody
    • GLE1 RNA export mediator like (yeast) antibody
    • GLE1-like protein antibody
    • GLE1_HUMAN antibody
    • GLE1L antibody
    • hGLE1 antibody
    • LCCS 1 antibody
    • LCCS antibody
    • LCCS1 antibody
    • Nucleoporin GLE1 antibody
    see all

Anti-GLE1 antibody images

  • Anti-GLE1 antibody (ab81648) at 1 µg/ml + placenta lysate at 10 ug protein.

    HRP conjugated anti-Rabbit IgG diluted 1/50,000 - 1/100,000.

    Predicted band size : 80 kDa
    Observed band size : 70 kDa (why is the actual band size different from the predicted?)
    Additional bands at : 35 kDa. We are unsure as to the identity of these extra bands.

References for Anti-GLE1 antibody (ab81648)

ab81648 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab81648.
Please use the links above to contact us or submit feedback about this product.