Overview

  • Product nameAnti-GLIPR1L1 antibody
    See all GLIPR1L1 primary antibodies
  • Description
    Rabbit polyclonal to GLIPR1L1
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Synthetic peptide corresponding to a region within internal sequence amino acids 179-228 (

    NMPPYVRGESCSLCSKEEKCVKNLCKNPFLKPTGRAPQQTAFNPFSLGFL

    ) of Human GLIPR1L1 (NP_689992).

  • Positive control
    • ACHN cell lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab102620 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 27 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

Anti-GLIPR1L1 antibody images

  • Anti-GLIPR1L1 antibody (ab102620) at 1 µg/ml + ACHN cell lysate at 10 µg

    Predicted band size : 27 kDa

References for Anti-GLIPR1L1 antibody (ab102620)

ab102620 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab102620.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"