Anti-GLO1 antibody [Glo1a] (ab171121)
Key features and details
- Mouse monoclonal [Glo1a] to GLO1
- Suitable for: WB, IHC-P
- Knockout validated
- Reacts with: Mouse, Rat, Human, African green monkey
- Isotype: IgG
Overview
-
Product name
Anti-GLO1 antibody [Glo1a]
See all GLO1 primary antibodies -
Description
Mouse monoclonal [Glo1a] to GLO1 -
Host species
Mouse -
Tested applications
Suitable for: WB, IHC-Pmore details -
Species reactivity
Reacts with: Mouse, Rat, Human, African green monkey -
Immunogen
Recombinant full length protein (proprietary-tag) corresponding to Human GLO1 aa 1-184.
Sequence:MAEPQPPSGGLTDEAALSCCSDADPSTKDFLLQQTMLRVKDPKKSLDFYT RVLGMTLIQKCDFPIMKFSLYFLAYEDKNDIPKEKDEKIAWALSRKATLE LTHNWGTEDDETQSYHNGNSDPRGFGHIGIAVPDVYSACKRFEELGVKFV KKPDDGKMKGLAFIQDPDGYWIEILNPNKMATLM
Database link: Q04760 -
Positive control
- HeLa, HepG2, 293T, A431, A549, MCF7, U2OS, K562, monkey COS7, mouse MEF, mouse C2C12 and rat NRK cell lysates; Human prostate and stomach cancer tissues.
-
General notes
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.
If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
Preservative: 0.05% Sodium azide
Constituents: 99% PBS, 0.1% BSA -
Concentration information loading...
-
Purity
Protein A purified -
Clonality
Monoclonal -
Clone number
Glo1a -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
-
Recombinant Protein
-
Related Products
Applications
The Abpromise guarantee
Our Abpromise guarantee covers the use of ab171121 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB |
1/1000. Predicted molecular weight: 21 kDa.
|
|
IHC-P |
1/800. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
|
Notes |
---|
WB
1/1000. Predicted molecular weight: 21 kDa. |
IHC-P
1/800. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. |
Target
-
Function
Catalyzes the conversion of hemimercaptal, formed from methylglyoxal and glutathione, to S-lactoylglutathione. -
Pathway
Secondary metabolite metabolism; methylglyoxal degradation; (R)-lactate from methylglyoxal: step 1/2. -
Sequence similarities
Belongs to the glyoxalase I family. - Information by UniProt
-
Database links
- Entrez Gene: 2739 Human
- Entrez Gene: 109801 Mouse
- Entrez Gene: 294320 Rat
- Omim: 138750 Human
- SwissProt: Q04760 Human
- SwissProt: Q9CPU0 Mouse
- SwissProt: Q6P7Q4 Rat
- Unigene: 268849 Human
see all -
Alternative names
- Aldoketomutase antibody
- glo1 antibody
- GLOD1 antibody
see all
Images
-
All lanes : Anti-GLO1 antibody [Glo1a] (ab171121) at 1/1000 dilution
Lane 1 : Wild-type HAP1 whole cell lysate
Lane 2 : GLO1 knockout HAP1 whole cell lysate
Lane 3 : HeLa whole cell lysate
Lane 4 : HepG2 whole cell lysate
Lysates/proteins at 20 µg per lane.
Predicted band size: 21 kDaLanes 1 - 4: Merged signal (red and green). Green - ab171121 observed at 21 kDa. Red - loading control, ab181602, observed at 37 kDa.
ab171121 was shown to specifically react with in wild-type HAP1 cells as signal was lost in GLO1 knockout cells. Wild-type and GLO1 knockout samples were subjected to SDS-PAGE. The membrane was blocked with 3% Milk. Ab171121 and ab181602 (Rabbit anti-GAPDH loading control) were incubated overnight at 4°C at 1/1000 dilution and 1/20000 dilution respectively. Blots were developed with Goat anti-Mouse IgG H&L (IRDye® 800CW) preabsorbed ab216772 and Goat anti-Rabbit IgG H&L (IRDye® 680RD) preabsorbed ab216777 secondary antibodies at 1/20000 dilution for 1 hour at room temperature before imaging.
-
Immunohistochemical analysis of deparaffinized Human stomach cancer tissue, labeling GLO1 with ab171121 at 1/800 dilution. Colorimetric detection was performed using metal enhanced DAB and tissues counterstained with hematoxylin.
-
All lanes : Anti-GLO1 antibody [Glo1a] (ab171121) at 1/1000 dilution
Lane 1 : HeLa cell lysate
Lane 2 : HepG2 cell lysate
Lane 3 : 293T cell lysate
Lane 4 : A431 cell lysate
Lane 5 : A549 cell lysate
Lane 6 : MCF7 cell lysate
Lane 7 : U2OS cell lysate
Lane 8 : K562 cell lysate
Lane 9 : monkey COS7 cell lysate
Lane 10 : mouse MEF cell lysate
Lane 11 : mouse C2C12 cell lysate
Lane 12 : rat NRK cell lysate
Lysates/proteins at 25 µg per lane.
Secondary
All lanes : goat anti-mouse-HRP at 1/20000 dilution
Predicted band size: 21 kDa -
Immunohistochemical analysis of deparaffinized Human prostate cancer tissue, labeling GLO1 with ab171121 at 1/800 dilution. Colorimetric detection was performed using metal enhanced DAB and tissues counterstained with hematoxylin.
Protocols
Datasheets and documents
-
Datasheet download
References (3)
ab171121 has been referenced in 3 publications.
- Lee HW et al. Glyoxal-Lysine Dimer, an Advanced Glycation End Product, Induces Oxidative Damage and Inflammatory Response by Interacting with RAGE. Antioxidants (Basel) 10:N/A (2021). PubMed: 34573117
- Cordone V et al. Antiglycative Activity and RAGE Expression in Rett Syndrome. Cells 8:N/A (2019). PubMed: 30781346
- Santini SJ et al. SIRT1-Dependent Upregulation of Antiglycative Defense in HUVECs Is Essential for Resveratrol Protection against High Glucose Stress. Antioxidants (Basel) 8:N/A (2019). PubMed: 31480513