Overview

  • Product name
    Anti-GLO1 antibody [Glo1a]
    See all GLO1 primary antibodies
  • Description
    Mouse monoclonal [Glo1a] to GLO1
  • Host species
    Mouse
  • Tested applications
    Suitable for: WB, IHC-P, ICC/IFmore details
  • Species reactivity
    Reacts with: Mouse, Rat, Human, Monkey
  • Immunogen

    Recombinant full length protein (proprietary-tag) corresponding to Human GLO1 aa 1-184.
    Sequence:

    MAEPQPPSGGLTDEAALSCCSDADPSTKDFLLQQTMLRVKDPKKSLDFYT RVLGMTLIQKCDFPIMKFSLYFLAYEDKNDIPKEKDEKIAWALSRKATLE LTHNWGTEDDETQSYHNGNSDPRGFGHIGIAVPDVYSACKRFEELGVKFV KKPDDGKMKGLAFIQDPDGYWIEILNPNKMATLM


    Database link: Q04760

  • Positive control
    • HeLa, HepG2, 293T, A431, A549, MCF7, U2OS, K562, monkey COS7, mouse MEF, mouse C2C12 and rat NRK cell lysates; Human prostate and stomach cancer tissues.

Properties

Applications

Our Abpromise guarantee covers the use of ab171121 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000. Predicted molecular weight: 21 kDa.
IHC-P 1/800. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
ICC/IF 1/800.

Target

  • Function
    Catalyzes the conversion of hemimercaptal, formed from methylglyoxal and glutathione, to S-lactoylglutathione.
  • Pathway
    Secondary metabolite metabolism; methylglyoxal degradation; (R)-lactate from methylglyoxal: step 1/2.
  • Sequence similarities
    Belongs to the glyoxalase I family.
  • Information by UniProt
  • Database links
  • Alternative names
    • Aldoketomutase antibody
    • glo1 antibody
    • GLOD1 antibody
    • Glx I antibody
    • GLYI antibody
    • glyoxalase domain containing 1 antibody
    • Glyoxalase I antibody
    • Ketone aldehyde mutase antibody
    • Ketone-aldehyde mutase antibody
    • Lactoyl glutathione lyase antibody
    • Lactoylglutathione lyase antibody
    • LGUL_HUMAN antibody
    • Methylglyoxalase antibody
    • S D lactoylglutathione methylglyoxal lyase antibody
    • S-D-lactoylglutathione methylglyoxal lyase antibody
    see all

Images

  • All lanes : Anti-GLO1 antibody [Glo1a] (ab171121) at 1/1000 dilution

    Lane 1 : HeLa cell lysate
    Lane 2 : HepG2 cell lysate
    Lane 3 : 293T cell lysate
    Lane 4 : A431 cell lysate
    Lane 5 : A549 cell lysate
    Lane 6 : MCF7 cell lysate
    Lane 7 : U2OS cell lysate
    Lane 8 : K562 cell lysate
    Lane 9 : monkey COS7 cell lysate
    Lane 10 : mouse MEF cell lysate
    Lane 11 : mouse C2C12 cell lysate
    Lane 12 : rat NRK cell lysate

    Lysates/proteins at 25 µg per lane.

    Secondary
    All lanes : goat anti-mouse-HRP at 1/20000 dilution

    Predicted band size: 21 kDa

  • Immunohistochemical analysis of deparaffinized Human stomach cancer tissue, labeling GLO1 with ab171121 at 1/800 dilution. Colorimetric detection was performed using metal enhanced DAB and tissues counterstained with hematoxylin.

  • Immunohistochemical analysis of deparaffinized Human prostate cancer tissue, labeling GLO1 with ab171121 at 1/800 dilution. Colorimetric detection was performed using metal enhanced DAB and tissues counterstained with hematoxylin.

References

ab171121 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab171121.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up