Overview

  • Product name
  • Description
    Rabbit polyclonal to GLTSCR1
  • Tested applications
    Suitable for: IHC-Pmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment corresponding to Human GLTSCR1 aa 1278-1343.
    Sequence:

    ASSLDADEDGPMPSRNRPPIKTYEARSRIGLKLKIKQEAGLSKVVHNTAL DPVHQPPPPPATLKVA


    Database link: Q9NZM4

  • Positive control
    • Human heart muscle tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab185677 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/50. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

Images

  • Immunohistochemical analysis of paraffin embedded Human heart muscle tissue labeling GLTSCR1 with ab185677 at 1/20.

References

ab185677 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab185677.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up