Overview

  • Product nameAnti-Glucokinase antibody
    See all Glucokinase primary antibodies
  • Description
    Mouse monoclonal to Glucokinase
  • Tested applicationsSuitable for: WB, ELISAmore details
  • Species reactivity
    Reacts with: Recombinant fragment
    Predicted to work with: Human
  • Immunogen

    Recombinant fragment corresponding to Human Glucokinase aa 41-142.
    Sequence:

    KKTYRDILTQGKDGVALKCEESGKEAKQAEMQLLVVHLSGSFEVISGRLL KREGHFMPPELLQSQFETLEPPAAPENFIQISVDKNVSEIIATIMETLKM K

Properties

Applications

Our Abpromise guarantee covers the use of ab76807 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/1000. Predicted molecular weight: 21 kDa.
ELISA Use at an assay dependent dilution.

Target

  • FunctionCatalyzes the initial step in utilization of glucose by the beta-cell and liver at physiological glucose concentration. Glucokinase has a high Km for glucose, and so it is effective only when glucose is abundant. The role of GCK is to provide G6P for the synthesis of glycogen. Pancreatic glucokinase plays an important role in modulating insulin secretion. Hepatic glucokinase helps to facilitate the uptake and conversion of glucose by acting as an insulin-sensitive determinant of hepatic glucose usage.
  • Tissue specificityIsoform 1 is expressed in pancreas. Isoform 2 and isoform 3 is expressed in liver.
  • Involvement in diseaseDefects in GCK are the cause of maturity-onset diabetes of the young type 2 (MODY2) [MIM:125851]; also shortened MODY-2. MODY is a form of diabetes that is characterized by an autosomal dominant mode of inheritance, onset in childhood or early adulthood (usually before 25 years of age), a primary defect in insulin secretion and frequent insulin-independence at the beginning of the disease.
    Defects in GCK are the cause of familial hyperinsulinemic hypoglycemia type 3 (HHF3) [MIM:602485]; also known as persistent hyperinsulinemic hypoglycemia of infancy (PHHI) or congenital hyperinsulinism. HHF is the most common cause of persistent hypoglycemia in infancy. Unless early and aggressive intervention is undertaken, brain damage from recurrent episodes of hypoglycemia may occur.
  • Sequence similaritiesBelongs to the hexokinase family.
  • Information by UniProt
  • Database links
  • Alternative names
    • ATP:D-hexose 6-phosphotransferase antibody
    • FGQTL3 antibody
    • GCK antibody
    • GK antibody
    • GLK antibody
    • Glucokinase antibody
    • Hexokinase D pancreatic isozyme antibody
    • Hexokinase type IV antibody
    • Hexokinase-4 antibody
    • Hexokinase-D antibody
    • HHF3 antibody
    • HK IV antibody
    • HK4 antibody
    • HKIV antibody
    • HXK4_HUMAN antibody
    • HXKP antibody
    • LGLK antibody
    • MODY2 antibody
    see all

Anti-Glucokinase antibody images

  • Anti-Glucokinase antibody (ab76807) at 1/500 dilution + immunogen (GST-tagged 101 residues recombinant fragment of Human C9orf103) at 0.2 µg

    Secondary
    Goat Anti-Mouse IgG (H&L) HRP-conjugated at 1/5000 dilution

    Predicted band size : 21 kDa
    Observed band size : 37 kDa (why is the actual band size different from the predicted?)
    MW of GST tag alone: 26 kDa

References for Anti-Glucokinase antibody (ab76807)

ab76807 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab76807.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"