Overview

Description

  • Nature
    Synthetic
  • Amino Acid Sequence
    • Sequence
      VVTVIVTMACYQLCGLNAIWFYTNSIFGKAGIPPAKIPYVTLSTGGIETL
    • Molecular weight
      56 kDa

Associated products

Specifications

Our Abpromise guarantee covers the use of ab105952 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Blocking - Blocking peptide for Anti-GLUT9 antibody (ab82910)

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.

General Info

  • Alternative names
    • glucose transporter 9
    • Glucose transporter like protein 9
    • Glucose transporter type 9
    • GLUT 9
    • GLUT-9
    • GLUT9
    • GLUTX
    • GTR9_HUMAN
    • Human glucose transporter like protein 9
    • SLC2A9
    • Solute carrier family 2 (facilitated glucose transporter) member 9
    • Solute carrier family 2 facilitated glucose transporter member 9
    • Solute carrier family 2 member 9
    • Solute carrier family 2 member 9 protein
    • Solute carrier family 2, facilitated glucose transporter member 9
    • UAQTL2
    • Urate voltage driven efflux transporter 1
    • URATv1
    see all
  • Function
    Transport urate and fructose. May have a role in the urate reabsorption by proximal tubules. Also transports glucose at low rate.
  • Tissue specificity
    Most strongly expressed in basolateral membranes of proximal renal tubular cells, liver and placenta. Also detected in lung, blood leukocytes, heart skeletal muscle and chondrocytes from articular cartilage. Isoform 2 is only detected in the apical membranes of polarized renal tubular cells and placenta. Isoform 1 and isoform 2 are detected in kidney membrane (at protein level).
  • Involvement in disease
    Hypouricemia renal 2
  • Sequence similarities
    Belongs to the major facilitator superfamily. Sugar transporter (TC 2.A.1.1) family. Glucose transporter subfamily.
  • Cellular localization
    Basolateral cell membrane and Apical cell membrane. Basolateral cell membrane.
  • Information by UniProt

References for GLUT9 peptide (ab105952)

ab105952 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab105952.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up