Anti-Glutathione S Transferase alpha 1 antibody [8-326] (HRP) (ab173836)

Overview

  • Product name
    Anti-Glutathione S Transferase alpha 1 antibody [8-326] (HRP)
    See all Glutathione S Transferase alpha 1 primary antibodies
  • Description
    Mouse monoclonal [8-326] to Glutathione S Transferase alpha 1 (HRP)
  • Conjugation
    HRP
  • Tested applications
    Suitable for: WBmore details
  • Immunogen

    Recombinant full length protein corresponding to Human Glutathione S Transferase alpha 1 aa 1-222.
    Sequence:

    MAEKPKLHYFNARGRMESTRWLLAAAGVEFEEKFIKSAEDLDKLRNDGYL MFQQVPMVEIDGMKLVQTRAILNYIASKYNLYGKDIKERALIDMYIEGIA DLGEMILLLPVCPPEEKDAKLALIKEKIKNRYFPAFEKVLKSHGQDYLVG NKLSRADIHLVELLYYVEELDSSLISSFPLLKALKTRISNLPTVKKFLQP GSPRKPPMDEKSLEEARKIFRF


    Database link: P08263

  • Positive control
    • Glutathione S Transferase alpha tagged fusion protein.

Properties

Applications

Our Abpromise guarantee covers the use of ab173836 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2000. Predicted molecular weight: 26 kDa.

Target

  • Function
    Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles.
  • Tissue specificity
    Liver.
  • Sequence similarities
    Belongs to the GST superfamily. Alpha family.
    Contains 1 GST C-terminal domain.
    Contains 1 GST N-terminal domain.
  • Domain
    The C-terminal domain may form a component of the hydrophobic substrate-binding site, but in contrast appears not to be directly involved in GSH binding and is not absolutely essential for catalytic activity.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt
  • Alternative names
    • Glutathione S alkyltransferase A1 antibody
    • Glutathione S aryltransferase A1 antibody
    • Glutathione S transferase 2 antibody
    • Glutathione S transferase A1 antibody
    • Glutathione S transferase alpha 1 antibody
    • Glutathione S transferase Ha subunit 1 antibody
    • Glutathione S-transferase A1 antibody
    • GST class-alpha member 1 antibody
    • GST epsilon antibody
    • GST HA subunit 1 antibody
    • GST, class alpha, 1 antibody
    • GST-epsilon antibody
    • GST2 antibody
    • GSTA1 1 antibody
    • GSTA1 antibody
    • GSTA1-1 antibody
    • GSTA1_HUMAN antibody
    • GTH1 antibody
    • HA subunit 1 antibody
    • MGC131939 antibody
    • OTTHUMP00000016611 antibody
    • S (hydroxyalkyl)glutathione lyase A1 antibody
    see all

Images

  • All lanes : Anti-Glutathione S Transferase alpha 1 antibody [8-326] (HRP) (ab173836) at 1/1000 dilution

    Lane 1 : purified Glutathione S Transferase alpha -SRC SH2 domain at 5 µg
    Lane 2 : purified Glutathione S Transferase alpha -SRC SH2 domain at 2.5 µg
    Lane 3 : purified Glutathione S Transferase alpha -SRC SH2 domain at 1 µg
    Lane 4 : purified Glutathione S Transferase alpha -SRC SH2 domain at 0.5 µg

    Developed using the ECL technique

    Predicted band size : 26 kDa

    4-20% Tris-HCl polyacrylamide gel.

References

ab173836 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab173836.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up