Anti-GSTT1 antibody (ab175418)
Key features and details
- Rabbit polyclonal to GSTT1
- Suitable for: WB
- Reacts with: Human
- Isotype: IgG
Get better batch-to-batch reproducibility with a recombinant antibody
- Research with confidence – consistent and reproducible results with every batch
- Long-term and scalable supply – powered by recombinant technology for fast production
- Success from the first experiment – confirmed specificity through extensive validation
- Ethical standards compliant – production is animal-free
Overview
-
Product name
Anti-GSTT1 antibody
See all GSTT1 primary antibodies -
Description
Rabbit polyclonal to GSTT1 -
Host species
Rabbit -
Tested applications
Suitable for: WBmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Cow -
Immunogen
Recombinant full length protein corresponding to Human GSTT1 aa 1-240.
Sequence:MGLELYLDLLSQPCRAVYIFAKKNDIPFELRIVDLIKGQHLSDAFAQVNP LKKVPALKDGDFTLTESVAILLYLTRKYKVPDYWYPQDLQARARVDEYLA WQHTTLRRSCLRALWHKVMFPVFLGEPVSPQTLAATLAELDVTLQLLEDK FLQNKAFLTGPHISLADLVAITELMHPVGAGCQVFEGRPKLATWRQRVEA AVGEDLFQEAHEVILKAKDFPPADPTIKQKLMPWVLAMIR
Database link: P30711 -
General notes
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.
If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.30
Preservative: 0.02% Sodium azide
Constituents: 49% PBS, 50% Glycerol -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
-
Recombinant Protein
Applications
The Abpromise guarantee
Our Abpromise guarantee covers the use of ab175418 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB |
1/500 - 1/2000. Predicted molecular weight: 27 kDa.
|
Notes |
---|
WB
1/500 - 1/2000. Predicted molecular weight: 27 kDa. |
Target
-
Function
Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles. Acts on 1,2-epoxy-3-(4-nitrophenoxy)propane, phenethylisothiocyanate 4-nitrobenzyl chloride and 4-nitrophenethyl bromide. Displays glutathione peroxidase activity with cumene hydroperoxide. -
Tissue specificity
Found in erythrocyte. Expressed at low levels in liver. In lung, expressed at low levels in Clara cells and ciliated cells at the alveolar/bronchiolar junction. Absent from epithelial cells of larger bronchioles. -
Sequence similarities
Belongs to the GST superfamily. Theta family.
Contains 1 GST C-terminal domain.
Contains 1 GST N-terminal domain. -
Cellular localization
Cytoplasm. - Information by UniProt
-
Database links
- Entrez Gene: 2952 Human
- Omim: 600436 Human
- SwissProt: P30711 Human
- Unigene: 268573 Human
- Unigene: 720100 Human
-
Alternative names
- EC 2.5.1.18 antibody
- Glutathione S transferase 5 antibody
- Glutathione S transferase theta 1 antibody
see all
Images
Datasheets and documents
-
SDS download
-
Datasheet download
References (1)
ab175418 has been referenced in 1 publication.
- Xie MY et al. 5-aza-2'-deoxycytidine in the regulation of antioxidant enzymes in retinal endothelial cells and rat diabetic retina. Int J Ophthalmol 12:1-7 (2019). PubMed: 30662833