Anti-Glutathione S Transferase theta 1 antibody (ab175418)

Overview

  • Product name
    Anti-Glutathione S Transferase theta 1 antibody
    See all Glutathione S Transferase theta 1 primary antibodies
  • Description
    Rabbit Polyclonal to Glutathione S Transferase theta 1
  • Tested applications
    Suitable for: IHC-P, WBmore details
  • Species reactivity
    Reacts with: Mouse, Rat, Human
    Predicted to work with: Cow
  • Immunogen

    Recombinant full length protein corresponding to Human Glutathione S Transferase theta 1 aa 1-240.
    Sequence:

    MGLELYLDLLSQPCRAVYIFAKKNDIPFELRIVDLIKGQHLSDAFAQVNP LKKVPALKDGDFTLTESVAILLYLTRKYKVPDYWYPQDLQARARVDEYLA WQHTTLRRSCLRALWHKVMFPVFLGEPVSPQTLAATLAELDVTLQLLEDK FLQNKAFLTGPHISLADLVAITELMHPVGAGCQVFEGRPKLATWRQRVEA AVGEDLFQEAHEVILKAKDFPPADPTIKQKLMPWVLAMIR


    Database link: P30711

  • Positive control
    • HepG2 cell extract.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    pH: 7.3
    Preservative: 0.02% Sodium azide
    Constituents: 49% PBS, 50% Glycerol
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab175418 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200.

ab171870 - Rabbit polyclonal IgG, is suitable for use as an isotype control with this antibody.

WB 1/500 - 1/2000. Predicted molecular weight: 27 kDa.

Target

  • Function
    Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles. Acts on 1,2-epoxy-3-(4-nitrophenoxy)propane, phenethylisothiocyanate 4-nitrobenzyl chloride and 4-nitrophenethyl bromide. Displays glutathione peroxidase activity with cumene hydroperoxide.
  • Tissue specificity
    Found in erythrocyte. Expressed at low levels in liver. In lung, expressed at low levels in Clara cells and ciliated cells at the alveolar/bronchiolar junction. Absent from epithelial cells of larger bronchioles.
  • Sequence similarities
    Belongs to the GST superfamily. Theta family.
    Contains 1 GST C-terminal domain.
    Contains 1 GST N-terminal domain.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt
  • Database links
  • Alternative names
    • EC 2.5.1.18 antibody
    • Glutathione S transferase 5 antibody
    • Glutathione S transferase theta 1 antibody
    • Glutathione S-transferase theta-1 antibody
    • Glutathione transferase T1 1 antibody
    • Glutathione transferase T1-1 antibody
    • GST 5 5 antibody
    • GST CL1 antibody
    • GST class theta 1 antibody
    • GST class-theta-1 antibody
    • GSTT1 antibody
    • GSTT1_HUMAN antibody
    see all

Images

  • Anti-Glutathione S Transferase theta 1 antibody (ab175418) at 1/500 dilution + HepG2 cell extract

    Predicted band size : 27 kDa

References

ab175418 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

The Anti-Glutathione S Transferase theta 1 antibody (ab81033) has not been tested for cross-reactivity with the GSTT2 protein. The short immunogen peptide (˜14 aa) used to raise this antibody has 100% homology to human GSTT1 protein. The immunogen pept...

Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up