Overview

  • Product name
    Anti-GLYATL1 antibody
  • Description
    Rabbit polyclonal to GLYATL1
  • Tested applications
    Suitable for: IHC-P, WBmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human GLYATL1 aa 104-173.
    Sequence:

    QGLQESLGEGIRVATFSKSVKVEHSRALLLVTEDILKLNASSKSKLGSWA ETGHPDDEFESETPNFKYAQ


    Database link: Q969I3

  • Positive control
    • Human kidney tissue; Human liver tissue lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab187859 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/500 - 1/1000. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
WB 1/100 - 1/250. Predicted molecular weight: 35 kDa.

Target

  • Relevance
    GLYATL1 is an acyltransferase which transfers the acyl group to the N-terminus of glycine. It can conjugate a multitude of substrates to form a variety of N-acylglycines.
  • Database links
  • Alternative names
    • Acyl CoA glycine N acyltransferase like protein 1 antibody
    • EC 2.3.1.13 antibody
    • FLJ26507 antibody
    • FLJ34646 antibody
    • GATF C antibody
    • GATFC antibody
    • Glutamine N acyltransferase antibody
    • Glycine N acyltransferase like 1 antibody
    • Glycine N acyltransferase like protein 1 antibody
    • GNAT antibody
    • MGC15397 antibody
    • MGC15937 antibody
    see all

Images

  • All lanes : Anti-GLYATL1 antibody (ab187859) at 1/100 dilution

    Lane 1 : RT-4 cell lysate
    Lane 2 : U-251MG sp cell lysate
    Lane 3 : Human plasma (IgG/HSA depleted) lysate
    Lane 4 : Human liver tissue lysate


    Predicted band size : 35 kDa
  • Immunohistochemical analysis of paraffin-embedded Human kidney tissue labeling GLYALT1 with ab187859 at 1/500 dilution.

References

ab187859 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab187859.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up