Anti-Glycerol 3 Phosphate Dehydrogenase antibody (HRP) (ab181629)

Overview

  • Product name
    Anti-Glycerol 3 Phosphate Dehydrogenase antibody (HRP)
    See all Glycerol 3 Phosphate Dehydrogenase primary antibodies
  • Description
    Goat polyclonal to Glycerol 3 Phosphate Dehydrogenase (HRP)
  • Conjugation
    HRP
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Rabbit
    Predicted to work with: Mouse, Rat, Cow, Human, Orangutan
  • Immunogen

    Full length native protein (purified) corresponding to Rabbit Glycerol 3 Phosphate Dehydrogenase aa 1-349. (Purified from Rabbit Muscle).
    Sequence:

    MAGKKVCIVGSGDWGSAIAKIVGGNAAQLAQFDPRVTMWVFEEDIGGKKL TEIINTHQENVKYLPGHKLPPNVVAVPDVVKAAADADILIFVVPHQFIGK ICDEIKGHLKANAIGISLIKGVNEGPKGLKLISEVIGEHLGIPMSVLMGA NIASEVADEKFCETTIGCKDQAQGQLLKQLMQTPNFRIVVTQEVNTVEIC GALKDLVAVGAGFCDGIGFGDNTKAAVIRLGLMEMIAFAKLFCSGPVSPA TFLESCGVADLITTCYGGRNRKVAEAFARTGKSIEQLEKEMLNGQKLQGP ETARELHSILQHKGLVDWFPLFMAVYKVCYQGQPVGEFIRCLQNHPEHM


    Database link: P08507

Properties

Applications

Our Abpromise guarantee covers the use of ab181629 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000 - 1/5000. Predicted molecular weight: 38 kDa.

Target

  • Sequence similarities
    Belongs to the NAD-dependent glycerol-3-phosphate dehydrogenase family.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt
  • Database links
  • Alternative names
    • AI747587 antibody
    • cytoplasmic antibody
    • EC 1.1.1.8 antibody
    • FLJ26652 antibody
    • G3PD antibody
    • Gdc-1 antibody
    • Gdc1 antibody
    • Gdp1 antibody
    • Glycerol 3 phosphate dehydrogenase 1 antibody
    • Glycerol 3 phosphate dehydrogenase cytosolic antibody
    • Glycerol 3 phosphate dehydrogenase soluble antibody
    • Glycerol-3-phosphate dehydrogenase [NAD+] antibody
    • Glycerol-3-phosphate dehydrogenase [NAD+], cytoplasmic antibody
    • Glycerol-3-phosphate dehydrogenase 1 (soluble) antibody
    • Glycerol-3-phosphate dehydrogenase antibody
    • Glycerol-3-phosphate dehydrogenase, soluble antibody
    • Glycerphosphate dehydrogenase antibody
    • GPD-C antibody
    • gpd1 antibody
    • Gpd1 protein antibody
    • Gpd3 antibody
    • GPDA_HUMAN antibody
    • Gpdc antibody
    • GPDH antibody
    • GPDH-C antibody
    • Gpdhc antibody
    • HTGTI antibody
    • KIAA4010 antibody
    • MGC93453 antibody
    • MGPD antibody
    • mKIAA4010 antibody
    see all

References

ab181629 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab181629.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up