Overview

  • Product nameAnti-Glyt2 antibody
    See all Glyt2 primary antibodies
  • Description
    Rabbit polyclonal to Glyt2
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog
  • Immunogen

    Synthetic peptide corresponding to a region within internal amino acids 503-552 (

    LIVTCTNSATSIFAGFVIFSVIGFMANERKVNIENVADQGPGIAFVVYPE

    ) of Human Glyt2 (NP_004202).

  • Positive control
    • PANC1 cell lysate

Properties

  • FormLiquid
  • Storage instructionsShipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
  • Storage bufferPreservative: None
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • PurityImmunogen affinity purified
  • ClonalityPolyclonal
  • IsotypeIgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab99098 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 87 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • FunctionTerminates the action of glycine by its high affinity sodium-dependent reuptake into presynaptic terminals. May be responsible for the termination of neurotransmission at strychnine-sensitive glycinergic synapses.
  • Tissue specificityExpressed in medulla, and to a lesser extent in spinal cord and cerebellum.
  • Involvement in diseaseHyperekplexia 3
  • Sequence similaritiesBelongs to the sodium:neurotransmitter symporter (SNF) (TC 2.A.22) family. SLC6A5 subfamily.
  • Cellular localizationMembrane.
  • Information by UniProt
  • Database links
  • Alternative names
    • Glycine transporter antibody
    • Glycine transporter type 2 antibody
    • GlyT-2 antibody
    • GlyT2 antibody
    • NET1 antibody
    • SC6A5_HUMAN antibody
    • SC6AC5 antibody
    • Slc6a5 antibody
    • SLC6A5 solute carrier family 6 neurotransmitter transporter, glycine member 5 antibody
    • Slc6a9 antibody
    • Sodium and chloride dependent glycine transporter 2 antibody
    • Sodium- and chloride-dependent glycine transporter 2 antibody
    • Solute carrier family 6 member 5 antibody
    • Solute carrier family 6 neurotransmitter transporter glycine member 5 antibody
    see all

Anti-Glyt2 antibody images

  • Anti-Glyt2 antibody (ab99098) at 1 µg/ml + PANC1 cell lysate at 10 µg

    Predicted band size : 87 kDa

References for Anti-Glyt2 antibody (ab99098)

This product has been referenced in:
  • Pienaar IS  et al. Mitochondrial abnormality associates with type-specific neuronal loss and cell morphology changes in the pedunculopontine nucleus in Parkinson disease. Am J Pathol 183:1826-40 (2013). Human . Read more (PubMed: 24099985) »

See 1 Publication for this product

Product Wall

Vielen Dank für Ihre Anfrage.

Um es gleich zu sagen: Die Chance, dass unsere Antikörper in EM getestet wurden, ist leider relativ gering. Das heißt, wir können die Anwendung nicht garantieren. Ich kann Ihnen aber einen Test- Rabatt ausstelle...

Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"