Anti-GPATCH2 antibody - N-terminal (ab182327)

Overview

  • Product name
    Anti-GPATCH2 antibody - N-terminal
  • Description
    Rabbit polyclonal to GPATCH2 - N-terminal
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Mouse
    Predicted to work with: Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Human, Pig
  • Immunogen

    Synthetic peptide within Mouse GPATCH2 aa 73-122 (N terminal). The exact sequence is proprietary.
    Sequence:

    RSYNVHHPWETGHCLSEGSDSSLEEPSKDYREKHSNNKKDRSDSDDQMLV


    Database link: Q7TQC7

  • Positive control
    • Mouse spleen lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab182327 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 58 kDa.

Target

Images

  • Anti-GPATCH2 antibody - N-terminal (ab182327) at 1 µg/ml + mouse spleen lysate at 10 µg

    Predicted band size: 58 kDa

References

ab182327 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab182327.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up