Overview

  • Product name
  • Description
    Rabbit polyclonal to GPCR GPR87
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Synthetic peptide corresponding to a region within N terminal amino acids 1-50 (

    MGFNLTLAKLPNNELHGQESHNSGNRSDGPGKNTTLHNEFDTIVLPVLY

    L) of Human GPCR GPR87 (NP_076404).

  • Positive control
    • NCI-H226 cell lysate.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
  • Storage buffer
    Preservative: None
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab104435 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 41 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • Function
    Receptor for lysophosphatidic acid (LPA). Necessary for p53/TP53-dependent survival in response to DNA damage.
  • Tissue specificity
    Expressed in placenta and prostate. Weaker expression in thymus. Not expressed in thalamus, hippocampus, pons or cerebellum. Overexpressed in squamous cell carcinoma of the lung.
  • Sequence similarities
    Belongs to the G-protein coupled receptor 1 family.
  • Cellular localization
    Cell membrane.
  • Information by UniProt
  • Database links
  • Alternative names
    • FKSG 78 antibody
    • FKSG78 antibody
    • G protein coupled receptor 87 antibody
    • G protein coupled receptor 95 antibody
    • G-protein coupled receptor 87 antibody
    • G-protein coupled receptor 95 antibody
    • GPCR87 antibody
    • GPR 87 antibody
    • GPR 95 antibody
    • Gpr87 antibody
    • GPR87_HUMAN antibody
    • GPR95 antibody
    • hGPCR87 antibody
    • KPG 002 antibody
    • KPG_002 antibody
    • MGC131898 antibody
    • Orphan GPCR 87 antibody
    • Probable G protein coupled receptor 87 antibody
    see all

Images

  • Anti-GPCR GPR87 antibody (ab104435) at 1 µg/ml + NCI-H226 cell lysate at 10 µg

    Predicted band size : 41 kDa

References

ab104435 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab104435.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up