Overview

  • Product nameAnti-GPCR GPR87 antibody
    See all GPCR GPR87 primary antibodies
  • Description
    Rabbit polyclonal to GPCR GPR87
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Synthetic peptide corresponding to a region within N terminal amino acids 1-50 (

    MGFNLTLAKLPNNELHGQESHNSGNRSDGPGKNTTLHNEFDTIVLPVLY

    L) of Human GPCR GPR87 (NP_076404).

  • Positive control
    • NCI-H226 cell lysate.

Properties

  • FormLiquid
  • Storage instructionsShipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
  • Storage bufferPreservative: None
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • PurityImmunogen affinity purified
  • ClonalityPolyclonal
  • IsotypeIgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab104435 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 41 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • FunctionReceptor for lysophosphatidic acid (LPA). Necessary for p53/TP53-dependent survival in response to DNA damage.
  • Tissue specificityExpressed in placenta and prostate. Weaker expression in thymus. Not expressed in thalamus, hippocampus, pons or cerebellum. Overexpressed in squamous cell carcinoma of the lung.
  • Sequence similaritiesBelongs to the G-protein coupled receptor 1 family.
  • Cellular localizationCell membrane.
  • Information by UniProt
  • Database links
  • Alternative names
    • FKSG 78 antibody
    • FKSG78 antibody
    • G protein coupled receptor 87 antibody
    • G protein coupled receptor 95 antibody
    • G-protein coupled receptor 87 antibody
    • G-protein coupled receptor 95 antibody
    • GPCR87 antibody
    • GPR 87 antibody
    • GPR 95 antibody
    • Gpr87 antibody
    • GPR87_HUMAN antibody
    • GPR95 antibody
    • hGPCR87 antibody
    • KPG 002 antibody
    • KPG_002 antibody
    • MGC131898 antibody
    • Orphan GPCR 87 antibody
    • Probable G protein coupled receptor 87 antibody
    see all

Anti-GPCR GPR87 antibody images

  • Anti-GPCR GPR87 antibody (ab104435) at 1 µg/ml + NCI-H226 cell lysate at 10 µg

    Predicted band size : 41 kDa

References for Anti-GPCR GPR87 antibody (ab104435)

ab104435 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab104435.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"