Overview

  • Product nameAnti-Granzyme H antibody
    See all Granzyme H primary antibodies
  • Description
    Rabbit polyclonal to Granzyme H
  • Tested applicationsSuitable for: WB, IHC-P, ELISAmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Horse, Cat
  • Immunogen

    Synthetic peptide corresponding to Human Granzyme H aa 1-50 (N terminal).
    Sequence:

    MQPFLLLLAFLLTPGAGTEEIIGGHEAKPHSRPYMAFVQFLQEKSRKRCG

  • Positive control
    • Jurkat Cell Lysate, human kidney tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab58852 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 2.5 µg/ml. Detects a band of approximately 35 kDa (predicted molecular weight: 27 kDa). Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.
IHC-P Use a concentration of 4 - 8 µg/ml.
ELISA Use at an assay dependent concentration.

Titre using peptide based assay: 1:1562500.

Target

  • FunctionCytotoxic chymotrypsin-like serine protease with preference for bulky and aromatic residues at the P1 position and acidic residues at the P3' and P4' sites. Probably necessary for target cell lysis in cell-mediated immune responses. Participates in the antiviral response via direct cleavage of several proteins essential for viral replication.
  • Tissue specificityConstituvely expressed in NK cells.
  • Sequence similaritiesBelongs to the peptidase S1 family. Granzyme subfamily.
    Contains 1 peptidase S1 domain.
  • Cellular localizationCytoplasmic granule. Cytoplasmic granules of cytolytic T-lymphocytes.
  • Information by UniProt
  • Database links
  • Alternative names
    • Cathepsin G like 2 antibody
    • Cathepsin G-like 2 antibody
    • CCP X antibody
    • CCP-X antibody
    • CGL 2 antibody
    • CGL2 antibody
    • CSP C antibody
    • CSP-C antibody
    • CTLA1 antibody
    • CTSGL2 antibody
    • Cytotoxic serine protease C antibody
    • Cytotoxic T lymphocyte associated serine esterase 1 antibody
    • Cytotoxic T lymphocyte proteinase antibody
    • Cytotoxic T-lymphocyte proteinase antibody
    • EC 3.4.21.- antibody
    • GRAH_HUMAN antibody
    • Granzyme H (cathepsin G-like 2, protein h-CCPX) antibody
    • Granzyme H antibody
    • GZMH antibody
    • Protein h CCPX antibody
    see all

Anti-Granzyme H antibody images

  • Anti-Granzyme H antibody (ab58852) at 2.5 µg/ml + Jurkat Cell Lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50,000 - 1/100,000 dilution.

    Predicted band size : 27 kDa
    Observed band size : 35 kDa (why is the actual band size different from the predicted?)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human kidney tissue labelling Granzyme H with ab58852 at 4-8µg/ml. Arrows indicate positively labelled epithelial cells of the renal tubule. Magnification: 400X.

References for Anti-Granzyme H antibody (ab58852)

ab58852 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab58852.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"