Overview

  • Product name
  • Description
    Rabbit polyclonal to GRPEL2
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog
  • Immunogen

    A synthetic peptide corresponding to a region within C terminal sequence 176-225 (

    HEHELICHVPAGVGVQPGTVALVRQDGYKLHGRTIRLARVEVAVESQRRL

    ) of Human GRPEL2, NP_689620

  • Positive control
    • Human fetal heart lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab85428 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 25 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • Function
    Essential component of the PAM complex, a complex required for the translocation of transit peptide-containing proteins from the inner membrane into the mitochondrial matrix in an ATP-dependent manner. Seems to control the nucleotide-dependent binding of mitochondrial HSP70 to substrate proteins. Stimulates ATPase activity of mt-HSP70. May also serve to modulate the interconversion of oligomeric (inactive) and monomeric (active) forms of mt-HSP70.
  • Sequence similarities
    Belongs to the grpE family.
  • Cellular localization
    Mitochondrion matrix.
  • Information by UniProt
  • Database links
  • Alternative names
    • GrpE like 2, mitochondrial antibody
    • GrpE protein homolog 2 antibody
    • GRPE2_HUMAN antibody
    • GRPEL 2 antibody
    • Grpel2 antibody
    • mitochondrial antibody
    • Mt GrpE#2 antibody
    • Mt-GrpE#2 antibody
    see all

Images

  • Anti-GRPEL2 antibody (ab85428) at 1 µg/ml (in 5% skim milk / PBS buffer) + fetal heart lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size: 25 kDa
    Observed band size: 28 kDa (why is the actual band size different from the predicted?)



    Gel concentration 12%

References

ab85428 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab85428.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up