Overview

  • Product nameAnti-GRPEL2 antibody
    See all GRPEL2 primary antibodies
  • Description
    Rabbit polyclonal to GRPEL2
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog
  • Immunogen

    A synthetic peptide corresponding to a region within C terminal sequence 176-225 (

    HEHELICHVPAGVGVQPGTVALVRQDGYKLHGRTIRLARVEVAVESQRRL

    ) of Human GRPEL2, NP_689620

  • Positive control
    • Human fetal heart lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab85428 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 25 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • FunctionEssential component of the PAM complex, a complex required for the translocation of transit peptide-containing proteins from the inner membrane into the mitochondrial matrix in an ATP-dependent manner. Seems to control the nucleotide-dependent binding of mitochondrial HSP70 to substrate proteins. Stimulates ATPase activity of mt-HSP70. May also serve to modulate the interconversion of oligomeric (inactive) and monomeric (active) forms of mt-HSP70.
  • Sequence similaritiesBelongs to the grpE family.
  • Cellular localizationMitochondrion matrix.
  • Information by UniProt
  • Database links
  • Alternative names
    • GrpE like 2, mitochondrial antibody
    • GrpE protein homolog 2 antibody
    • GRPE2_HUMAN antibody
    • GRPEL 2 antibody
    • Grpel2 antibody
    • mitochondrial antibody
    • Mt GrpE#2 antibody
    • Mt-GrpE#2 antibody
    see all

Anti-GRPEL2 antibody images

  • Anti-GRPEL2 antibody (ab85428) at 1 µg/ml (in 5% skim milk / PBS buffer) + fetal heart lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 25 kDa
    Observed band size : 28 kDa (why is the actual band size different from the predicted?)

References for Anti-GRPEL2 antibody (ab85428)

ab85428 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab85428.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"