Overview

  • Product name
  • Description
    Goat polyclonal to GST
  • Host species
    Goat
  • Tested applications
    Suitable for: WB, ELISA, IHC-Pmore details
  • Species reactivity
    Reacts with: Other
  • Immunogen

    Full length protein corresponding to Schistosoma japonicum GST aa 2-218.
    Sequence:

    SPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLE FPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLD IRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHP DFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAW PLQGWQATFGGGDHPPK


    Database link: P08515

  • Positive control
    • Glutathione-S-Transferase [Schistosoma japonicum]

Properties

Applications

Our Abpromise guarantee covers the use of ab181652 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000 - 1/5000.
ELISA 1/200 - 1/1000.

ab181652 has been assayed against 1.0 ug of Glutathione-S-Transferase [Schistosoma japonicum] in a standard sandwich ELISA using Peroxidase conjugated Affinity Purified anti-Goat IgG [H&L] (Rabbit) and ABTS (2,2’-azino-bis-[3-ethylbenthiazoline-6-sulfonic acid) as a substrate for 30 minutes at room temperature. A working dilution of 1/3,000 to 1/15,000 of the reconstitution concentration is suggested for this product.

IHC-P Use at an assay dependent concentration.

Target

  • Relevance
    GST (Glutathione S-Transferase) is a 26kDa protein encoded by the parasitic helminth Schistosoma japonicum and widely used in the pGEX family of GST plasmid expression vectors as a fusion protein with foreign proteins.
  • Alternative names
    • Glutathione S Transferase antibody
    • Glutathione S-transferase class-mu 26 kDa isozyme antibody
    • GST antibody
    • Sj26 antigen antibody
    • SjGST antibody
    see all

Images

  • Lanes 1-4 : Anti-GST antibody (ab181652) at 1/5000 dilution
    Lane 5 : Anti-GST antibody (ab181652) at 1/1000 dilution (Reduced)
    Lane 6 : Anti-GST antibody (ab181652) at 1/1000 dilution (Non-reduced)

    Lanes 1 & 3 & 5-6 : Purified GST at 1 µg
    Lanes 2 & 4 : Purified GST at 0.25 µg


    ab181652 was used to detect GST under reducing and non-reducing conditions. Reduced samples of purified GST contained 4% BME and were boiled for 5 minutes. For lanes 1-4, samples of ~1 and 0.25 ug of protein per lane were run by SDS-PAGE. Protein was transferred to nitrocellulose and probed with a Goat anti GST at 1/5000 dilution overnight at 4°C. Primary antibody was detected with a conjugated Donkey anti Goat at 1/10000, incubated for 1.5 hr at RT and imaged on the BioRad VersaDoc imaging system. Lanes 5-6 show a repeat western blot with the same samples (~1 ug per lane, reduced (R) and nonreduced (NR) detected with a Dylight 549 conjugated Donkey anti goat incubated at 1/10000 at 1.5 hours at RT.

References

ab181652 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab181652.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up