Overview

  • Product nameAnti-GST antibody
    See all GST primary antibodies
  • Description
    Goat polyclonal to GST
  • Tested applicationsSuitable for: WB, IP, ELISA, Dot blotmore details
  • Immunogen

    Full length protein corresponding to Schistosoma japonicum GST aa 2-218.
    Sequence:

    SPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLE FPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLD IRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHP DFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAW PLQGWQATFGGGDHPPK


    Database link: P08515

Properties

Applications

Our Abpromise guarantee covers the use of ab6612 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000 - 1/5000.
IP Use at an assay dependent concentration.
ELISA 1/10000 - 1/50000.
Dot blot Use at an assay dependent concentration.

Target

  • RelevanceGST (Glutathione S-Transferase) is a 26kDa protein encoded by the parasitic helminth Schistosoma japonicum and widely used in the pGEX family of GST plasmid expression vectors as a fusion protein with foreign proteins.
  • Alternative names
    • Glutathione S Transferase antibody
    • Glutathione S-transferase class-mu 26 kDa isozyme antibody
    • GST antibody
    • Sj26 antigen antibody
    • SjGST antibody
    see all

References for Anti-GST antibody (ab6612)

ab6612 has not yet been referenced specifically in any publications.

Product Wall

This antibody will not distinguish GSTT1 from GSTT2 due to it being polyclonal and therefore will recognise the homologous regions of both molecules.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"