Overview

  • Product name
  • Description
    Goat polyclonal to GST
  • Tested applications
    Suitable for: WB, IP, ELISA, Dot blotmore details
  • Immunogen

    Full length protein corresponding to Schistosoma japonicum GST aa 2-218.
    Sequence:

    SPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLE FPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLD IRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHP DFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAW PLQGWQATFGGGDHPPK


    Database link: P08515

Properties

Applications

Our Abpromise guarantee covers the use of ab6612 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000 - 1/5000.
IP Use at an assay dependent concentration.
ELISA 1/10000 - 1/50000.
Dot blot Use at an assay dependent concentration.

Target

  • Relevance
    GST (Glutathione S-Transferase) is a 26kDa protein encoded by the parasitic helminth Schistosoma japonicum and widely used in the pGEX family of GST plasmid expression vectors as a fusion protein with foreign proteins.
  • Alternative names
    • Glutathione S Transferase antibody
    • Glutathione S-transferase class-mu 26 kDa isozyme antibody
    • GST antibody
    • Sj26 antigen antibody
    • SjGST antibody
    see all

References

ab6612 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

This antibody will not distinguish GSTT1 from GSTT2 due to it being polyclonal and therefore will recognise the homologous regions of both molecules.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up