
  • Product name
  • Description
    Rabbit polyclonal to GSTM1
  • Host species
  • Tested applications
    Suitable for: IHC-P, WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Cow
  • Immunogen

    Synthetic peptide corresponding to a region within internal amino acids 132-181 sequence (PEKLKLYSEFLGKRPWFAGNKGLEKISAYMKSSRFLPRPVFSKMAVWGN K) of human GSTM1 (NP_666533)

  • Positive control
    • Hela cell lysate



Our Abpromise guarantee covers the use of ab108084 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use at an assay dependent concentration.
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 26 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.



  • Anti-GSTM1 antibody (ab108084) at 1 µg/ml + Hela cell lysate at 10 µg

    Predicted band size: 26 kDa

    Gel concentration: 12%
  • ab108084 staining GSTM1 in liver tissue by Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections).
  • ab108084 staining GSTM1 in testis tissue by Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections).


ab108084 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

I can confirm that none of our antibodies below against GSTM1 has been experimentally tested for its cross-reactivity with other family member.

I have therefore checked for homology with the immunogen:


Read More

I checked the immunogen sequence, and this actually corresponds to the shorter isoform for the GSTM1 protein which has a molecular weight of 21 kDa, which explains the smaller band size.

Please see the following UniProt protein database page f...

Read More


Sign up