Overview

  • Product nameAnti-GTF2F1 antibody
    See all GTF2F1 primary antibodies
  • Description
    Rabbit polyclonal to GTF2F1
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Guinea pig, Cow, Cat, Dog, Saccharomyces cerevisiae
  • Immunogen

    Synthetic peptide, corresponding to a region within amino acids 36-85 (

    KVNFATWNQARLERDLSNKKIYQEEEMPESGAGSEFNRKLREEARRKKYG

    ) of Human GTF2F1 (NP_002087).

  • Positive control
    • HT1080 cell lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab94651 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 58 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • FunctionTFIIF is a general transcription initiation factor that binds to RNA polymerase II and helps to recruit it to the initiation complex in collaboration with TFIIB. It promotes transcription elongation.
  • Sequence similaritiesBelongs to the TFIIF alpha subunit family.
  • Post-translational
    modifications
    Phosphorylated on Ser and other residues by TAF1 and casein kinase II-like kinases.
  • Cellular localizationNucleus.
  • Information by UniProt
  • Database links
  • Alternative names
    • 2810405L04Rik antibody
    • BTF4 antibody
    • C76800 antibody
    • General transcription factor IIF 74 kDa subunit antibody
    • General transcription factor IIF subunit 1 antibody
    • General transcription factor IIF, polypeptide 1, 74kDa antibody
    • Gtf2f1 antibody
    • MGC94148 antibody
    • OTTHUMP00000237859 antibody
    • RAP74 antibody
    • T2FA_HUMAN antibody
    • TF2F1 antibody
    • TFIIF antibody
    • TFIIF-alpha antibody
    • Transcription initiation factor IIF subunit alpha antibody
    • Transcription initiation factor RAP74 antibody
    see all

Anti-GTF2F1 antibody images

  • Anti-GTF2F1 antibody (ab94651) at 1 µg/ml (in 5% skim milk / PBS buffer) + HT1080 cell lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 58 kDa

References for Anti-GTF2F1 antibody (ab94651)

ab94651 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab94651.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"