Overview

  • Product name
  • Description
    Rabbit polyclonal to GTF2F2
  • Tested applications
    Suitable for: WB, IHC-Pmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cow
  • Immunogen

    Recombinant full length protein corresponding to Human GTF2F2 aa 1-249.
    Sequence:

    MAERGELDLTGAKQNTGVWLVKVPKYLSQQWAKASGRGEVGKLRIAKTQG RTEVSFTLNEDLANIHDIGGKPASVSAPREHPFVLQSVGGQTLTVFTESS SDKLSLEGIVVQRAECRPAASENYMRLKRLQIEESSKPVRLSQQLDKVVT TNYKPVANHQYNIEYERKKKEDGKRARADKQHVLDMLFSAFEKHQYYNLK DLVDITKQPVVYLKEILKEIGVQNVKGIHKNTWELKPEYRHYQGEEKSD


    Database link: P13984

Properties

Applications

Our Abpromise guarantee covers the use of ab192499 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use at an assay dependent concentration. Predicted molecular weight: 28 kDa.
IHC-P Use at an assay dependent concentration.

Target

  • Function
    TFIIF is a general transcription initiation factor that binds to RNA polymerase II and helps to recruit it to the initiation complex in collaboration with TFIIB. It promotes transcription elongation. This subunit shows ATP-dependent DNA-helicase activity.
  • Sequence similarities
    Belongs to the TFIIF beta subunit family.
  • Post-translational
    modifications
    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localization
    Nucleus.
  • Information by UniProt
  • Database links
  • Alternative names
    • ATP dependent helicase GTF2F2 antibody
    • ATP-dependent helicase GTF2F2 antibody
    • BTF4 antibody
    • General transcription factor IIF 30 kDa subunit antibody
    • General transcription factor IIF polypeptide 2 antibody
    • General transcription factor IIF subunit 2 antibody
    • General transcription factor IIF, polypeptide 2, 30kDa antibody
    • Gtf2f2 antibody
    • RAP30 antibody
    • T2FB_HUMAN antibody
    • TF2F2 antibody
    • TFIIF antibody
    • TFIIF beta antibody
    • TFIIF-beta antibody
    • Transcription initiation factor IIF subunit beta antibody
    • Transcription initiation factor RAP30 antibody
    see all

References

ab192499 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab192499.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up