Overview

  • Product name
  • Description
    Rabbit polyclonal to HAGH
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WB, ELISAmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Horse, Guinea pig, Cow, Cat, Dog
  • Immunogen

    Synthetic peptide corresponding to Human HAGH aa 230-279 (C terminal).
    Sequence:

    FARHVEPGNAAIREKLAWAKEKYSIGEPTVPSTLAEEFTYNPFMRVREKT

  • Positive control
    • Fetal liver lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab75787 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 29 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.
ELISA Use at an assay dependent concentration.

ELISA titre using peptide based assay: 1/1562500.

Target

Images

  • Anti-HAGH antibody (ab75787) at 1 µg/ml + Fetal liver lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size: 29 kDa
    Observed band size: 29 kDa

References

ab75787 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Thank you very much for your inquiry about ab75787. I can confirm that we do currently not have an antibody against HAGH that is tested in IHC.

To our knowledge, ab75787 has not been tested in IHC. Therefore, I can offer a discount off a fut...

Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up