Overview

  • Product name
  • Description
    Rabbit polyclonal to HAO1
  • Host species
    Rabbit
  • Tested applications
    Suitable for: IHC-P, WBmore details
  • Species reactivity
    Reacts with: Mouse, Human
  • Immunogen

    Recombinant full length protein corresponding to Human HAO1 aa 1-370.
    Sequence:

    MLPRLICINDYEQHAKSVLPKSIYDYYRSGANDEETLADNIAAFSRWKLY PRMLRNVAETDLSTSVLGQRVSMPICVGATAMQRMAHVDGELATVRACQS LGTGMMLSSWATSSIEEVAEAGPEALRWLQLYIYKDREVTKKLVRQAEKM GYKAIFVTVDTPYLGNRLDDVRNRFKLPPQLRMKNFETSTLSFSPEENFG DDSGLAAYVAKAIDPSISWEDIKWLRRLTSLPIVAKGILRGDDAREAVKH GLNGILVSNHGARQLDGVPATIDVLPEIVEAVEGKVEVFLDGGVRKGTDV LKALALGAKAVFVGRPIVWGLAFQGEKGVQDVLEILKEEFRLAMALSGCQ NVKVIDKTLVRKNPLAVSKI


    Database link: Q9UJM8

  • Positive control
    • Mouse and Rat liver extracts.

Properties

Applications

Our Abpromise guarantee covers the use of ab194790 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use at an assay dependent concentration.
WB Use at an assay dependent concentration. Predicted molecular weight: 41 kDa.

Target

  • Function
    Has 2-hydroxyacid oxidase activity. Most active on the 2-carbon substrate glycolate, but is also active on 2-hydroxy fatty acids, with high activity towards 2-hydroxy palmitate and 2-hydroxy octanoate.
  • Tissue specificity
    Liver.
  • Pathway
    Organic acid metabolism; glycolate degradation; 3-phospho-D-glycerate from glycolate: step 1/4.
  • Sequence similarities
    Belongs to the FMN-dependent alpha-hydroxy acid dehydrogenase family.
    Contains 1 FMN hydroxy acid dehydrogenase domain.
  • Cellular localization
    Peroxisome.
  • Information by UniProt
  • Database links
  • Alternative names
    • (S) 2 hydroxy acid oxidase antibody
    • Glycolate oxidase antibody
    • GOX antibody
    • GOX1 antibody
    • HAO1 antibody
    • HAOX1 antibody
    • HAOX1_HUMAN antibody
    • Hydroxyacid oxidase 1 antibody
    • MGC142225 antibody
    • MGC142227 antibody
    • OTTHUMP00000030231 antibody
    see all

Images

  • All lanes : Anti-HAO1 antibody (ab194790) at 1/500 dilution

    Lane 1 : Mouse liver extract
    Lane 2 : Rat liver extract

    Predicted band size: 41 kDa

References

ab194790 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab194790.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up