Overview

  • Product name
  • Description
    Rabbit polyclonal to HAPLN1
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Pig
  • Immunogen

    Synthetic peptide corresponding to a region within N-terminal amino acids 35-84 (

    ENGPHLLVEAEQAKVFSHRGGNVTLPCKFYRDPTAFGSGIHKIRIKWTKL

    ) of Human HAPLN1 (NP_001875).

  • Positive control
    • NCI-H226 cell lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab98038 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 40 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • Function
    Stabilizes the aggregates of proteoglycan monomers with hyaluronic acid in the extracellular cartilage matrix.
  • Tissue specificity
    Widely expressed. Weakly expressed in the brain.
  • Sequence similarities
    Belongs to the HAPLN family.
    Contains 1 Ig-like V-type (immunoglobulin-like) domain.
    Contains 2 Link domains.
  • Cellular localization
    Secreted, extracellular space, extracellular matrix.
  • Information by UniProt
  • Database links
  • Alternative names
    • Cartilage link protein antibody
    • cartilage linking protein 1 antibody
    • Cartilage-link protein antibody
    • Cartilage-linking protein 1 antibody
    • CLP antibody
    • CRTL1 antibody
    • Crtl1l antibody
    • HAPLN1 antibody
    • HPLN1_HUMAN antibody
    • Hyaluronan and proteoglycan link protein 1 antibody
    • Hyaluronan and proteoglycan link protein 1 precursor antibody
    • LP antibody
    • Proteoglycan link protein antibody
    see all

Anti-HAPLN1 antibody images

  • Anti-HAPLN1 antibody (ab98038) at 1 µg/ml (in 5% skim milk / PBS buffer) + NCI-H226 Cell Lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 40 kDa

References for Anti-HAPLN1 antibody (ab98038)

This product has been referenced in:
  • Végh MJ  et al. Hippocampal extracellular matrix levels and stochasticity in synaptic protein expression increase with age and are associated with age-dependent cognitive decline. Mol Cell Proteomics 13:2975-85 (2014). Read more (PubMed: 25044018) »

See 1 Publication for this product

Product Wall

There are currently no Abreviews or Questions for ab98038.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up