Overview

  • Product name
  • Description
    Rabbit polyclonal to HAPLN1
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Pig
  • Immunogen

    Synthetic peptide corresponding to a region within N-terminal amino acids 35-84 (

    ENGPHLLVEAEQAKVFSHRGGNVTLPCKFYRDPTAFGSGIHKIRIKWTKL

    ) of Human HAPLN1 (NP_001875).

  • Positive control
    • NCI-H226 cell lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab98038 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 40 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • Function
    Stabilizes the aggregates of proteoglycan monomers with hyaluronic acid in the extracellular cartilage matrix.
  • Tissue specificity
    Widely expressed. Weakly expressed in the brain.
  • Sequence similarities
    Belongs to the HAPLN family.
    Contains 1 Ig-like V-type (immunoglobulin-like) domain.
    Contains 2 Link domains.
  • Cellular localization
    Secreted, extracellular space, extracellular matrix.
  • Information by UniProt
  • Database links
  • Alternative names
    • Cartilage link protein antibody
    • cartilage linking protein 1 antibody
    • Cartilage-link protein antibody
    • Cartilage-linking protein 1 antibody
    • CLP antibody
    • CRTL1 antibody
    • Crtl1l antibody
    • HAPLN1 antibody
    • HPLN1_HUMAN antibody
    • Hyaluronan and proteoglycan link protein 1 antibody
    • Hyaluronan and proteoglycan link protein 1 precursor antibody
    • LP antibody
    • Proteoglycan link protein antibody
    see all

Images

  • Anti-HAPLN1 antibody (ab98038) at 1 µg/ml (in 5% skim milk / PBS buffer) + NCI-H226 Cell Lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 40 kDa

References

This product has been referenced in:
  • Végh MJ  et al. Hippocampal extracellular matrix levels and stochasticity in synaptic protein expression increase with age and are associated with age-dependent cognitive decline. Mol Cell Proteomics 13:2975-85 (2014). Read more (PubMed: 25044018) »

See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab98038.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up